Mr026 precursor (P05408) Protein Card

General Information
Name Mr026 precursor
Alternative name(s) Mr026
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I2 superfamily
Pharmacological family

Sequence
MSGHTSVNFLLLSIVALGMVATVIC
LCDSYISSELCEHPEE
TCLLPQSYVLSVESIQTGSVYVLGSVPHISKTS
G
Sequence region
[1-25]signal sequence
[26-74]mature peptideMr026

References
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Nucleic acids
Structure

External links

Tools