Mr8.2 precursor (P05492) Protein Card

General Information

Name	Mr8.2 precursor
Alternative name(s)	Mr096
Organism	Conus marmoreus
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Precursor
Notes	The gene superfamily associated with this precursor was described as "B superfamily" in Dutertre et al 2013, but this name was already assigned to the conantokin precursors by Puillandre et al. 2012 J Mol Evol, therefore the superfamily was renamed "B2 superfamily".

Classification

Conopeptide class	conotoxin
Gene superfamily	B2 superfamily
Pharmacological family

Sequence

MLRLITAAVLVSACLA YPQKKRTPPQTRPTSR ALVSQCRPC PTCRECKCRECKCRECQCRIHSCLSAWDSRGIWMRT
Sequence region	[1-16] signal sequence [33-77] mature peptide Mr8.2

References

Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links

Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Sunday 28 May 2023