VxXXIVA (P05526) Protein Card

General Information

Name	VxXXIVA
Alternative name(s)	Vx24a
Organism	Conus vexillum
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	VxXXIVA precursor (5525)
Notes	None of the three studied disulfide isomers shown any three-dimensional structuration in solution (Luo 2013).

Classification

Conopeptide class	conotoxin
Gene superfamily	B3 superfamily
Cysteine framework	XXIV
Pharmacological family	alpha conotoxin

Sequence

VRCLEKSGAQPNKLFRPPCCQKGPSFARHSRCVYYTQSRE
Sequence evidence	nucleic acid level
Average Mass	4625.31
Monoisotopic Mass	4622.24
Isoelectric Point	12.38
Extinction Coefficient [280nm]	2980.00

Activity

IC50: Nicotinic acetylcholine receptors

Target	Organism		IC50		nhill	Agonist	Ref
α1β1γδ	M. musculus	(connectivity 1-2;3-4)	6.6uM	+/-1.9	1.2	10uM ACh	Luo,S. et al. (2013)
α2β2	R. norvegicus	(connectivity 1-2;3-4)	23.4uM	+/-9.1	1.1	100uM ACh	Luo,S. et al. (2013)
α2β4	R. norvegicus	(connectivity 1-2;3-4)	>30uM			100uM ACh	Luo,S. et al. (2013)
α3β2	R. norvegicus	(connectivity 1-2;3-4)	>30uM			100uM ACh	Luo,S. et al. (2013)
α3β4	R. norvegicus	(connectivity 1-2;3-4)	>30uM			100uM ACh	Luo,S. et al. (2013)
α4β2	R. norvegicus	(connectivity 1-2;3-4)	>30uM			100uM ACh	Luo,S. et al. (2013)
α4β4	R. norvegicus	(connectivity 1-2;3-4)	>30uM			100uM ACh	Luo,S. et al. (2013)
α6/α3β2β3	R. norvegicus	(connectivity 1-2;3-4)	12.2uM	+/-2.7	1.2	100uM ACh	Luo,S. et al. (2013)
α6/α3β4	R. norvegicus	(connectivity 1-2;3-4)	30.1uM	+/-17.9	1	100uM ACh	Luo,S. et al. (2013)
α7	R. norvegicus	(connectivity 1-2;3-4)	>30uM			200uM ACh	Luo,S. et al. (2013)
α9α10	R. norvegicus	(1-3;2-4 with Ba2+)	3.15 uM	+/-1.6	0.6	10uM ACh	Luo,S. et al. (2013)
		(connectivity 1-4;2-3)	>30uM			10uM ACh	Luo,S. et al. (2013)
		(connectivity 1-2;3-4)	1.2uM	+/-0.5	1.4	10uM ACh	Luo,S. et al. (2013)
		(connectivity 1-3;2-4)	3.9uM	+/-1.7	1.3	10uM ACh	Luo,S. et al. (2013)
		(1-2;3-4 with Ba2+)	1.49uM	+/-0.4	0.8	10uM ACh	Luo,S. et al. (2013)

References

Luo,S., Christensen,S., Zhangsun,D., Wu,Y., Hu,Y., Zhu,X., Chhabra,S., Norton,R.S. and McIntosh,J.M. (2013) A novel inhibitor of α9α10 nicotinic acetylcholine receptors from Conus vexillum delineates a new conotoxin superfamily. PLoS ONE 8

Internal links

Protein Precursor	VxXXIVA precursor (5525)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 21 March 2023