PuIA precursor (P05622) Protein Card

General Information

Name	PuIA precursor
Alternative name(s)	73826
Organism	Conus pulicarius
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Precursor
Notes	Required frameshifting to optimize alignment with the reference sequence (see Lluisma 2012).

Classification

Conopeptide class	conotoxin
Gene superfamily	O1 superfamily
Pharmacological family

Sequence

MKLTCMMIVAVLFLTAWTFVTA DSIRALEDLFAKAPDEMEN SRASPLNE RDCRPVGQYCGIPYEHNWRCCSQLCAIICVS
Sequence region	[1-22] signal sequence [50-80] mature peptide PuIA

References

Lluisma,A.O., Milash,B.A., Moore,B., Olivera,B.M. and Bandyopadhyay,P.K. (2012) Novel venom peptides from the cone snail Conus pulicarius discovered through next-generation sequencing of its venom duct transcriptome. Mar Genomics 5:43-51

Internal links

Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Friday 31 March 2023