Pu6.34 (P05630) Protein Card

General Information

Name	Pu6.34
Organism	Conus pulicarius
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	Pu6.34 precursor (5629)
Notes	Predicted by ConoServer from protein precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	O3 superfamily
Cysteine framework	VI/VII
Pharmacological family

Sequence

AVDEECNEYCEERKDKNCCGRTNGEPRCATMCF
Sequence evidence	nucleic acid level
Average Mass	3799.14
Monoisotopic Mass	3796.46
Isoelectric Point	4.97
Extinction Coefficient [280nm]	1490.00

References

Lluisma,A.O., Milash,B.A., Moore,B., Olivera,B.M. and Bandyopadhyay,P.K. (2012) Novel venom peptides from the cone snail Conus pulicarius discovered through next-generation sequencing of its venom duct transcriptome. Mar Genomics 5:43-51

Internal links

Protein Precursor	Pu6.34 precursor (5629)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 26 September 2023