Con-ikot-ikot-G6 precursor (P05791) Protein Card

General Information
Name Con-ikot-ikot-G6 precursor
Alternative name(s) G53
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class con-ikot-ikot
Gene superfamily
Pharmacological family

Sequence
MAMSMSMTLSVFVMVVMA
ATVTGFTQLKKPDLSRMKR
NNKV
CCNQRNLPMSEAEILDKKVITLTHVNKKAVTSCPGSDIDGC
CPGYTMCMSTNAQNNVHTAHTSCLNRPCFGPC
K
Sequence region
[1-18]signal sequence
[38-114]mature peptideCon-ikot-ikot-G6

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Nucleic acids
Structure

External links

Tools