Con-ikot-ikot-G3 (P05798) Protein Card

General Information

Name	Con-ikot-ikot-G3
Organism	Conus geographus (Geography cone)
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Con-ikot-ikot-G3 precursor (5797)
Notes	Predicted by ConoServer from protein precursor

Classification

Conopeptide class	con-ikot-ikot
Gene superfamily
Cysteine framework	XXI
Pharmacological family

Sequence

CCINKTYECLKNYRNRENKFASFCQQEAAVYCGTFESGTGC CYGYMNCMMINAERDGREKAHGYCQHRIC
Sequence evidence	nucleic acid level
Average Mass	8107.13
Monoisotopic Mass	8101.38
Isoelectric Point	10.82
Extinction Coefficient [280nm]	8940.00

References

Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links

Protein Precursor	Con-ikot-ikot-G3 precursor (5797)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Wednesday 27 September 2023