Lv5.7 (P06508) Protein Card

General Information
Name Lv5.7
Organism Conus lividus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lv5.7 precursor (6132)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily T superfamily
Cysteine framework V
Pharmacological family

Sequence
FLTQQSPRDFAKSVMQLLHYNWIDCCNYGVSDCCI
Sequence evidence nucleic acid level
Average Mass 4095.66
Monoisotopic Mass 4092.81
Isoelectric Point 6.85
Extinction Coefficient [280nm] 8480.00

References

Internal links
Protein Precursor Lv5.7 precursor (6132)
Nucleic acids
Structure

External links

Tools