Mi017 (P06748) Protein Card

General Information
Name Mi017
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Mi017 precursor (6696)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ECREKGQGCTNTALCCPGLECEGQSQGGLCVDNKWRLMFPL
GALSCAA
Sequence evidence nucleic acid level
Average Mass 5043.75
Monoisotopic Mass 5040.20
Isoelectric Point 5.10
Extinction Coefficient [280nm] 5625.00

References

Internal links
Protein Precursor Mi017 precursor (6696)
Nucleic acids
Structure

External links

Tools