Mi019 (P06750) Protein Card

General Information
Name Mi019
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Mi019 precursor (6698)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ECREKGQGCTNTALCCPGLECEGQSQGGCAWTLSGV
Sequence evidence nucleic acid level
Average Mass 3671.04
Monoisotopic Mass 3668.49
Isoelectric Point 4.50
Extinction Coefficient [280nm] 5500.00

References

Internal links
Protein Precursor Mi019 precursor (6698)
Nucleic acids
Structure

External links

Tools