Vn6.1 precursor (P00691) Protein Card

General Information

Name	Vn6.1 precursor
Alternative name(s)	VnMEKL-0221
Organism	Conus ventricosus
Organism region	Eastern Atlantic and Mediterranean
Organism diet	vermivorous
Protein Type	Precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	O2 superfamily
Pharmacological family

Sequence

MEKLTILLLVAAVLMWTQA LIQEKRPKEKIKFLSKR KTTAE SWWEGECSGWSVYCTQHSECCSGECTGNYCELF
Sequence region	[1-19] signal sequence [37-74] mature peptide Vn6.1

References

Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links

Nucleic acids	Conus ventricosus clone VnMEKL-0221 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links

UniProtKB/Swiss-Prot	Q9BPD0
Ncbi	AAG60432, Q9BPD0

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 5 June 2023