TxMEKL-0422 precursor (scaffold VI/VII) (P00709) Protein Card

General Information
Name TxMEKL-0422 precursor (scaffold VI/VII)
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
NPASCCSCADVDPGRASRKTPKGEDQVFIKEKDRC

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus textile clone TxMEKL-0422 conotoxin scaffold VI/VII precursor, mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot Q9BPB3
Ncbi AAG60450, Q9BPB3

Tools