TxMEKL-053 precursor (P00713) Protein Card

General Information

Name	TxMEKL-053 precursor
Alternative name(s)	TxMEKL-053
Organism	Conus textile (Cloth-of-gold cone)
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	O2 superfamily
Pharmacological family

Sequence

MEKLTILLLVAAVLMSTQA LNQEQHQRAKINLLSKRKPPAE R WWECGIWFSRCTKDSECCSNSCDQTYCELMPFPPDW
Sequence region	[1-19] signal sequence [43-78] mature peptide TxMEKL-053

References

Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links

Nucleic acids	Conus textile clone TxMEKL-053 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links

UniProtKB/Swiss-Prot	Q9BPB0
Ncbi	AAG60454, Q9BPB0

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Wednesday 29 November 2023