PnVIIA precursor (P00716) Protein Card

General Information

Name	PnVIIA precursor
Alternative name(s)	PnMEKL-011
Organism	Conus pennaceus
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	O2 superfamily
Pharmacological family

Sequence

MEKLTILLLVAAVLMSTQA QNQEQRQQAKINFLSKRKPSAE RWRR DCTSWFGRCTVNSECCSNSCDQTYCELYAFPS FGA
Sequence region	[1-19] signal sequence [46-77] mature peptide PnVIIA

References

Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Fainzilber,M., Nakamura,T., Lodder,J.C., Zlotkin,E., Kits,K.S. and Burlingame,A.L. (1998) gamma-Conotoxin-PnVIIA, a gamma-carboxyglutamate-containing peptide agonist of neuronal pacemaker cation currents Biochemistry 37:1470-1477

Internal links

Nucleic acids	Conus pennaceus clone PnMEKL-011 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links

UniProtKB/Swiss-Prot	Q9BPA8
Ncbi	AAG60457

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 2 October 2023