PVIIA [insN_GGG,insC_LPET] cyclic (P07500) Protein Card

General Information

Name	PVIIA [insN_GGG,insC_LPET] cyclic (named by ConoServer)
Alternative name(s)	cyclic-[GGG]PVIIA[LPET]
Organism	synthetic construct
Protein Type	Synthetic
Parent	PVIIA
Notes	Cyclized by Sortase A

Classification

Conopeptide class	conotoxin
Gene superfamily
Cysteine framework	VI/VII
Pharmacological family

Sequence

GGGORIPNQKCFQHLDDCCSRKCNRFNKCVLPET

Modified residues

position	symbol	name
4	O	4-Hydroxyproline

Average Mass

3858.40

Monoisotopic Mass

3855.75

Isoelectric Point

11.80

Extinction Coefficient [280nm]

Activity

IC50: Voltage-Gated Potassium Channels

Target	Organism	IC50		Ref
Kv Shaker	D. melanogaster	824 nM	+/-60	Kwon,S. et al. (2016)

Percentage inhibition: Voltage-Gated Potassium Channels

Target	Organism	Concentration	Ref
K_v1.3	H. sapiens	1 uM	Kwon,S. et al. (2016)
K_v1.6	R. norvegicus	1 uM	Kwon,S. et al. (2016)
K_v2.1	R. norvegicus	1 uM	Kwon,S. et al. (2016)

Percentage inhibition: Voltage-Gated Sodium Channels

Target	Organism	% inhibition		Concentration	Ref
Na_v1.4	R. norvegicus	0		1 uM	Kwon,S. et al. (2016)
Na_v1.6	H. sapiens	0		1 uM	Kwon,S. et al. (2016)

References

Kwon,S., Bosmans,F., Kaas,Q., Cheneval,O., Conibear,A.C., Rosengren,K.J., Wang,C.K., Schroeder,C.I. and Craik,D.J. (2016) Efficient enzymatic cyclization of an inhibitory cystine knot-containing peptide. Biotechnol. Bioeng. 113:2202-2212

Internal links

Nucleic acids
Structure	Three-dimensional structure of cyclic PVIIA

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 21 March 2023