ConoNPY-Bt2 (P07537) Protein Card

General Information

Name	ConoNPY-Bt2
Alternative name(s)	Cono-NPY
Organism	Conus betulinus
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type

Classification

Conopeptide class	conoNPY
Gene superfamily
Pharmacological family

Sequence

TVSDPPARPAVFHSREELMNYVRELNLYFAIVGRPRY(nh2)
Modified residues	position symbol name 38 nh2 C-term amidation
Sequence evidence	protein level
Average Mass	4364.02
Monoisotopic Mass	4361.26
Isoelectric Point	11.07
Extinction Coefficient [280nm]	4470.00

References

Wu,X., Shao,X., Guo,Z.Y. and Chi,C.W. (2010) Identification of neuropeptide Y-like conopeptides from the venom of Conus betulinus. Acta Biochim. Biophys. Sin. (Shanghai) 42:502-505

Internal links

Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Wednesday 22 March 2023