Ca4.2 (P07760) Protein Card

General Information
Name Ca4.2 (named by ConoServer)
Alternative name(s) Ca-117
Organism Conus caracteristicus (characteristic cone)
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IV
Pharmacological family

Sequence
RYVENKQDLSPDERMGIRSTVTSPEGQKCCLSGFCDGACRQ
CKDTCE
Sequence evidence nucleic acid level
Average Mass 5239.81
Monoisotopic Mass 5236.27
Isoelectric Point 5.96
Extinction Coefficient [280nm] 1490.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Nucleic acids
Structure

External links

Tools