Cal30 precursor (P07876) Protein Card

General Information

Name	Cal30 precursor (named by ConoServer)
Alternative name(s)	O2_cal30 precursor
Organism	Conus californicus
Organism region	Eastern Pacific
Organism diet	piscivorous
Protein Type	Precursor

Classification

Conopeptide class	conotoxin
Gene superfamily
Cysteine framework	XXX
Pharmacological family

Sequence

MEKLIILLLVASLLVTTDSVVKGK KAARGWLFNEVETCELG GLGDPCSGSGDCCCDQCLCSGSYEHCTQNPDRWFCCRTYGN
Sequence region	[1-24] signal sequence [25-82] mature peptide Cal30

References

Bernáldez-Sarabia,J., Figueroa-Montiel,A., Dueñas,S., Cervantes-Luévano,K., Beltrán,J.A., Ortiz,E., Jiménez,S., Possani,L.D., Paniagua-Solís,J.F., Gonzalez-Canudas,J., and Licea-Navarro,A. (2019) The Diversified O-Superfamily in Californiconus californicus Presents a Conotoxin with Antimycobacterial Activity Toxins 11:128

Internal links

Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 27 March 2023