Conantokin-T32 precursor (P07969) Protein Card

General Information
Name Conantokin-T32 precursor (named by ConoServer)
Alternative name(s) Tu031 precursor
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conantokin
Gene superfamily B2 superfamily
Pharmacological family

Sequence
MLRLIIAAVLASACLAY
PQRRDGVPEDASNLQGFDQGMQAM
PNMQGMQGMPMPGMAGGQFLPFNPNLAVPYKR
GEELEERSH
HSKFNGDSDNSPFQSEDGLENFMDFMKDNSNENLPLQQRGR
RHQ
Sequence evidence nucleic acid level
Sequence region
[1-17]signal sequence
[74-126]mature peptideConantokin-T32

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Nucleic acids
Structure

External links

Tools