Conantokin-T27 (P08043) Protein Card

General Information

Name	Conantokin-T27 (named by ConoServer)
Alternative name(s)	Tu026
Organism	Conus tulipa (tulip cone)
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Conantokin-T27 precursor (7964)

Classification

Conopeptide class	conantokin
Gene superfamily	B1 superfamily
Pharmacological family

Sequence

GEEEYQKMLENLREAEAKKGKDNQSWVFHLIPVSSKIPR
Sequence evidence	nucleic acid level
Average Mass	4586.21
Monoisotopic Mass	4583.36
Isoelectric Point	8.31
Extinction Coefficient [280nm]	6990.00

References

Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links

Protein Precursor	Conantokin-T27 precursor (7964)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 26 September 2023