Conantokin-T31 (P08053) Protein Card

General Information
Name Conantokin-T31 (named by ConoServer)
Alternative name(s) Tu030
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Conantokin-T31 precursor (7968)

Classification
Conopeptide class conantokin
Gene superfamily B2 superfamily
Pharmacological family

Sequence
GEELEERSHHSKFNGDSDNSPFQSEDGLETSWTS
Sequence evidence nucleic acid level
Average Mass 3839.87
Monoisotopic Mass 3837.63
Isoelectric Point 4.40
Extinction Coefficient [280nm] 5500.00

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Protein Precursor Conantokin-T31 precursor (7968)
Nucleic acids
Structure

External links

Tools