Conantokin-T32 (P08055) Protein Card

General Information
Name Conantokin-T32 (named by ConoServer)
Alternative name(s) Tu031
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Conantokin-T32 precursor (7969)

Classification
Conopeptide class conantokin
Gene superfamily B2 superfamily
Pharmacological family

Sequence
GEELEERSHHSKFNGDSDNSPFQSEDGLENFMDFMKDNSNE
NLPLQQRGRRHQ
Sequence evidence nucleic acid level
Average Mass 6235.58
Monoisotopic Mass 6231.78
Isoelectric Point 4.97
Extinction Coefficient [280nm] NA

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Protein Precursor Conantokin-T32 precursor (7969)
Nucleic acids
Structure

External links

Tools