Cal12.5 (P08315) Protein Card

General Information

Name	Cal12.5 (named by ConoServer)
Alternative name(s)	O1_cal12c
Organism	Conus californicus
Organism region	Eastern Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Cal12.5 precursor (7874)

Classification

Conopeptide class	conotoxin
Gene superfamily	O1 superfamily
Cysteine framework	XII
Pharmacological family

Sequence

SVCDFGSCVHNGCYCEEHRPCCTPGSCSSWWPRCPGSMMDP
Sequence evidence	nucleic acid level
Average Mass	4505.01
Monoisotopic Mass	4501.62
Isoelectric Point	6.38
Extinction Coefficient [280nm]	12490.00

References

Bernáldez-Sarabia,J., Figueroa-Montiel,A., Dueñas,S., Cervantes-Luévano,K., Beltrán,J.A., Ortiz,E., Jiménez,S., Possani,L.D., Paniagua-Solís,J.F., Gonzalez-Canudas,J., and Licea-Navarro,A. (2019) The Diversified O-Superfamily in Californiconus californicus Presents a Conotoxin with Antimycobacterial Activity Toxins 11:128

Internal links

Protein Precursor	Cal12.5 precursor (7874)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 21 March 2023