Am6.6 precursor (P08406) Protein Card

General Information
Name Am6.6 precursor (named by ConoServer)
Organism Conus amadis
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
MEKLTILLLVAAILMSTQA
LNQEQRQQAKINLLSKKKPSAE
RWRR
GCTWWFGRCAEDGECCSNSCDQTYCELYAFPS
RAI
Sequence evidence nucleic acid level
Sequence region
[1-19]signal sequence
[20-45]pro region
[46-77]mature peptideAm6.6

References
Vijayasarathy, M. and Balaram, P. (2019) Cone snail prolyl-4-hydroxylase α-subunit sequences derived from transcriptomic data and mass spectrometric analysis of variable proline hydroxylation in C. amadis venom Journal of proteomics 194:37-48

Internal links
Nucleic acids Am6.6 precursor
Structure

External links
Ncbi MH282827

Tools