Con-ikot-ikot-Lt1 (P08433) Protein Card

General Information

Name	Con-ikot-ikot-Lt1 (named by ConoServer)
Organism	Conus litteratus
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	Con-ikot-ikot-Lt1 precursor (8432)

Classification

Conopeptide class	con-ikot-ikot
Gene superfamily
Pharmacological family

Sequence

GDTSAECCLTLLGCYNTCMLDHISSDCWEHCKSENTIQCSL DFSLYYCNSFQSCYQICIRTKHESHCFRGCKYEAMGDCLET GVVECCPGFMMCYNNCEHSHAYCMTHCTKGSC
Sequence evidence	nucleic acid level
Average Mass	12901.47
Monoisotopic Mass	12892.01
Isoelectric Point	6.61
Extinction Coefficient [280nm]	15930.00

References

Zhang, H., Fu, Y., Wang, L., Liang, A., Chen, S. and Xu, A. (2019) Identifying novel conopepetides from the venom ducts of Conus litteratus through integrating transcriptomics and proteomics Journal of proteomics 192:346-357

Internal links

Protein Precursor	Con-ikot-ikot-Lt1 precursor (8432)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Saturday 1 April 2023