Cal8.1 (P08453) Protein Card

General Information

Name	Cal8.1 (named by ConoServer)
Alternative name(s)	CalMKLL-1
Organism	Conus californicus
Organism region	Eastern Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Cal8.1 precursor (4055)

Classification

Conopeptide class	conotoxin
Gene superfamily	Divergent MKLLLTLLLG
Cysteine framework	VIII
Pharmacological family

Sequence

DECGLGTHRPVKEVIDNVRTMYYCDCRAGDAERSITVSRCD DNNQKQDDVILTYCGLEQTTGCNTNPYTAAKHDSSGDKPQF YCSCLNYKYEQSHSDYRHWTIRCYMGNICD
Average Mass	12871.14
Monoisotopic Mass	12862.66
Isoelectric Point	6.73
Extinction Coefficient [280nm]	20160.00

References

Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links

Protein Precursor	Cal8.1 precursor (4055)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 27 March 2023