Conantokin-E1 precursor (P08464) Protein Card

General Information
Name Conantokin-E1 precursor (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Western Atlantic and Caribbean,Eastern Atlantic and Mediterranean
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conantokin
Gene superfamily B1 superfamily
Pharmacological family

Sequence
MQLYTYLYLLVPLVTFHLILG
MGTLDHGGALTERRSADATA
LKPEPVLLQKSDARSTDDNDKDRLTQMKRILKKRGNKAR
GE
EEHSKYQECLREIRVNNVQQEC
Sequence evidence nucleic acid level
Sequence region
[1-21]signal sequence
[22-80]pro region
[81-104]mature peptideConantokin-E1

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Nucleic acids Conantokin-E1 precursor
Structure

External links

Tools