Conkunitzin-E1 precursor (P08475) Protein Card

General Information
Name Conkunitzin-E1 precursor (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Western Atlantic and Caribbean,Eastern Atlantic and Mediterranean
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conkunitzin
Gene superfamily
Pharmacological family

Sequence
MTCFRSAVYPLLLTATVIVVATGNRCRLEPDAGLCRAAIDQ
FYYNWNERQCQTFIYGGCGGNDNRFGTREECEQACTVPSRN
RDCNWPKETGPCRARFPSFFYDLNTGKCQDFIYGGCGGNAN
RFDTLDDCEQRCAVVCQEPKQVGLCRAAFRRWFYNRNSMMC
ERFIYGGCGGNRNNFQTFSECRDQCMLK
Sequence evidence nucleic acid level

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Nucleic acids Conkunitzin-E1 precursor
Structure

External links
Ncbi AXL95354

Tools