E20.1 precursor (P08482) Protein Card

General Information

Name	E20.1 precursor (named by ConoServer)
Organism	Conus ermineus (Atlantic fish-hunting cone)
Organism region	Eastern Atlantic and Mediterranean,Western Atlantic and Caribbean
Organism diet	piscivorous
Protein Type	Precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	D superfamily
Cysteine framework	XX
Pharmacological family

Sequence

MPRLEMMLLVLLILPLPYFNAAGG QAVQGDGQGDRMDRYLQ RGDR AVIATCHPNYPGSPWGRCCTTKMCGSVCCNYAHCSCV YHSDMGDGCSC
Sequence evidence	nucleic acid level
Sequence region	[1-24] signal sequence [25-45] pro region [46-93] mature peptide E20.1

References

Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links

Nucleic acids	E20.1 precursor
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Saturday 25 March 2023