E22.1 precursor (P08484) Protein Card

General Information
Name E22.1 precursor (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Western Atlantic and Caribbean,Eastern Atlantic and Mediterranean
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily E superfamily
Cysteine framework XXII
Pharmacological family

Sequence
MMTRVFIAMFFLLALTEG
WPRLTDSDCELGRNMHITCKQLD
QCGVIEKKDGQLTCKLRCKCKPGKRCLRKENIDWSDITTRI
YHCPWP
Sequence evidence nucleic acid level
Sequence region
[1-18]signal sequence
[19-88]mature peptideE22.1

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Nucleic acids E22.1 precursor
Structure

External links

Tools