Sa27.1 (P08603) Protein Card

General Information

Name	Sa27.1 (named by ConoServer)
Alternative name(s)	San001
Organism	Conus sanguinolentus
Organism region	Indo-Pacific
Protein Type	Wild type
Protein precursor	Sa27.1 precursor (8602)

Classification

Conopeptide class	conotoxin
Gene superfamily	G2 superfamily
Cysteine framework	XXVII
Pharmacological family

Sequence

RDCQTGCVGCHNPAGCCCGGQVCVDNKRCEGGFY
Sequence evidence	nucleic acid level
Average Mass	3532.91
Monoisotopic Mass	3530.30
Isoelectric Point	7.98
Extinction Coefficient [280nm]	1490.00

References

Jin, A.H., Dekan, Z., Smout, M.J., Wilson, D., Dutertre, S., Vetter, I., Lewis, R.J., Loukas, A., Daly, N.L. and Alewood, P.F. (2017) Conotoxin Φ‐MiXXVIIA from the Superfamily G2 Employs a Novel Cysteine Framework that Mimics Granulin and Displays Anti‐Apoptotic Activity Angewandte Chemie International Edition 56:14973-14976

Internal links

Protein Precursor	Sa27.1 precursor (8602)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Sunday 11 June 2023