Im6.9 (P08750) Protein Card

General Information
Name Im6.9 (named by ConoServer)
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im6.9 precursor (8749)

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
WWEGECYDWLRQCSSPAQCCSGNCGAHCKAW
Sequence evidence protein level
Average Mass 3559.91
Monoisotopic Mass 3557.33
Isoelectric Point 6.62
Extinction Coefficient [280nm] 23490.00

References
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Protein Precursor Im6.9 precursor (8749)
Nucleic acids
Structure

External links

Tools