Im14.2 precursor (P08759) Protein Card

General Information
Name Im14.2 precursor (named by ConoServer)
Alternative name(s) Im025SF_im1_1
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XIV
Pharmacological family

Sequence
MARFLSILLCFAMATGLAAG
IRYPDRVLGR
CSTHDLSKMEI
DTNLDGVYSPHRSFCTCGSGEVYFTAKDRRNHSNYRVYVCG
MPTEFCTAENPVRDP
KKGNRWLQCRCRQYKMVIYRDWLVLC
E
Sequence evidence nucleic acid level
Sequence region
[1-20]signal sequence
[31-97]mature peptideIm14.2

References
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Nucleic acids Im14.2 precursor
Structure

External links

Tools