Im026 (P08762) Protein Card

General Information
Name Im026 (named by ConoServer)
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im026 precursor (8761)

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
DCTGQACTTGDNCPSECVCNEHHFCTGKCCYFLHA
Sequence evidence protein level
Average Mass 3791.14
Monoisotopic Mass 3788.34
Isoelectric Point 6.25
Extinction Coefficient [280nm] 1490.00

References
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Protein Precursor Im026 precursor (8761)
Nucleic acids
Structure

External links

Tools