Im20.1 precursor (P08763) Protein Card

General Information
Name Im20.1 precursor (named by ConoServer)
Alternative name(s) Im027SF_im3_1
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XX
Pharmacological family

Sequence
MSKSGMLLFVLLLLLPLAIP
ELAPAGRSVTHHFRDFGAKR
S
VPISCVNPSTPNLQGSWQDKKCCSTKLCSPTNCCESSTCSC
VEGSCQCL
Sequence evidence nucleic acid level
Sequence region
[1-20]signal sequence
[41-90]mature peptideIm20.1

References
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Nucleic acids Im20.1 precursor
Structure

External links

Tools