conophysin-M (P08930) Protein Card

General Information

Name	conophysin-M (named by ConoServer)
Organism	Conus monile
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	conophysin-conopressin-M1 precursor (8929)

Classification

Conopeptide class	conophysin
Gene superfamily
Pharmacological family

Sequence

QPTKPCMNCSFGQCVGPRVCCGAGRCEIGSTEADRCEEENE DPVPCKVLGQHCVLNNPGNVNGNCVDGGIGICCVDDTCAIH RRCD
Sequence evidence	protein level
Average Mass	9059.10
Monoisotopic Mass	9052.77
Isoelectric Point	4.97
Extinction Coefficient [280nm]	125.00

References

Kumar,S., Vijayasarathy,M., Venkatesha,M.A., Sunita,P. and Balaram,P. (2020) Cone Snail Analogs of the Pituitary Hormones Oxytocin/Vasopressin and Their Carrier Protein Neurophysin. Proteomic and Transcriptomic Identification of Conopressins and Conophysins Biochim Biophys Acta Proteins Proteom 1868:140391

Internal links

Protein Precursor	conophysin-conopressin-M1 precursor (8929)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Wednesday 27 September 2023