LtVIA precursor (P09817) Protein Card

General Information
Name LtVIA precursor (named by ConoServer)
Alternative name(s) Lt037 precursor
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLIIAVLFLMDNQLITA
DYSRDEQVYRAVRLR
DAMQ
KSKGSGSCAYISEPCDILPCCPGLKCNEDFVPICL
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[38-76]mature peptideLtVIA
Average Mass 8491.04
Monoisotopic Mass 8485.18
Isoelectric Point 6.69
Extinction Coefficient [280nm] 5345.00

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Nucleic acids LtVIA, complete cds
Structure

External links

Tools