Lt15.14 (P09829) Protein Card

General Information
Name Lt15.14 (named by ConoServer)
Alternative name(s) Lt092
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt15.14 precursor (9830)

Classification
Conopeptide class conotoxin
Gene superfamily Divergent MSTLGMTLL-
Cysteine framework XV
Pharmacological family

Sequence
CSTKMCGEDCCPSTSCECETVGSQSNEVGCSCPV
Average Mass 3456.76
Monoisotopic Mass 3454.17
Isoelectric Point 3.91
Extinction Coefficient [280nm] NA

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Protein Precursor Lt15.14 precursor (9830)
Nucleic acids
Structure

External links

Tools