Lt9.3 (P09831) Protein Card

General Information
Name Lt9.3 (named by ConoServer)
Alternative name(s) Lt005
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt9.3 precursor (9832)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
QCPVTGGPTPMYHCMMACMTTSTEYWCQHEYCSDCAE
Sequence evidence nucleic acid level
Average Mass 4190.70
Monoisotopic Mass 4187.49
Isoelectric Point 6.00
Extinction Coefficient [280nm] 9970.00

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Protein Precursor Lt9.3 precursor (9832)
Nucleic acids
Structure

External links

Tools