Conkunitzin-Lt5 (P09872) Protein Card

General Information
Name Conkunitzin-Lt5 (named by ConoServer)
Alternative name(s) Lt068
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Conkunitzin-Lt5 precursor (9873)

Classification
Conopeptide class conkunitzin
Gene superfamily
Pharmacological family

Sequence
DVLLSACKLPAKTGPCYSFVRKYYFDWDSVNCKTFIYGGCD
GNSNNFCTYNECYSRCGPVN
Sequence evidence nucleic acid level
Average Mass 6893.71
Monoisotopic Mass 6889.00
Isoelectric Point 9.23
Extinction Coefficient [280nm] 14565.00

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Protein Precursor Conkunitzin-Lt5 precursor (9873)
Nucleic acids
Structure

External links

Tools