Lt32.1 (P09878) Protein Card

General Information
Name Lt32.1 (named by ConoServer)
Alternative name(s) Lt086
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt32.1 precursor (9879)

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Cysteine framework XXXII
Pharmacological family

Sequence
SSCGYLGQQCCIVPKRAYCHGDLECNPVAMCVA
Sequence evidence nucleic acid level
Average Mass 3514.06
Monoisotopic Mass 3511.47
Isoelectric Point 8.15
Extinction Coefficient [280nm] 2980.00

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Protein Precursor Lt32.1 precursor (9879)
Nucleic acids
Structure

External links

Tools