Lt20.1 (P09884) Protein Card

General Information
Name Lt20.1 (named by ConoServer)
Alternative name(s) Lt087
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt20.1 precursor (9885)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XX
Pharmacological family

Sequence
REVPLTCHPPSTPNLNGPWQDQKCCLTKQCSPTNCCTSTSC
VCDMSICDCSGM
Sequence evidence nucleic acid level
Average Mass 5715.47
Monoisotopic Mass 5711.27
Isoelectric Point 5.96
Extinction Coefficient [280nm] 5500.00

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Protein Precursor Lt20.1 precursor (9885)
Nucleic acids
Structure

External links

Tools