Protein List
Your search: Protein Type in [Wild type] and Sequence evidence in [protein level] and PTM in [4-Hydroxyproline]
| ID | Name | Gene superfamily | Organism | Sequence | |
|---|---|---|---|---|---|
| P08391 | Am1.5 | A superfamily | Conus amadis | ROECCSHOACNVDHOEIC | |
| P08407 | Am6.6 | O2 superfamily | Conus amadis | GCTWWFGRCAEDGECCSNSCDQTYCELYAFOS | |
| P05524 | As25a | Conus austini | CKCOSCNFNDVTENCKCCIFRQO(nh2) | ||
| P10045 | Ba6.1 | U superfamily | Conus bayani | SSQSTCOYCQISCCOOAYCQOSGCRGP | |
| P10041 | Ba9.1 | P superfamily | Conus bayani | VSCG(Gla)YCGDYGDCOSSCOTCTSNLLKCM | |
| P03551 | Bromocontryphan-S | Conus striatus (Striated cone) | GCO(Btr)EPWC(nh2) | ||
| P01811 | Bromosleeper peptide | O3 superfamily | Conus radiatus | (Btr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW QCV(Gla)ACPV |
|
| P02526 | BtX | I2 superfamily | Conus betulinus | CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR HP(nh2) |
|
| P04080 | C4.1 | A superfamily | Conus catus | QKELVPSTITTCCGNEPGTMCPKCMCDNTCOPKKKKRP | |
| P03087 | C6.1 | O1 superfamily | Conus catus | YGCSNAGAFCGIHOGLCCSELCLGWCT | |
| P09974 | C6.2 | O1 superfamily | Conus catus | DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2) | |
| P08523 | C8.4 | S superfamily | Conus catus | ZYPLGCOGTCGKGGKCVGTCECTNYTNCYCSSKGFREPGCS CTCPT |
|
| P04136 | Cal5.1 L1a | Divergent MRFYIGLMAA | Conus californicus | DAADVKOVARTNEGOGRDOAOCCQHPIETCC | |
| P02840 | CaXVIIA | Y superfamily | Conus caracteristicus (characteristic cone) | CGGTGDSCNEOAGELCCRRLKCVNSRCCPTTDGC | |
| P01510 | CcTx | A superfamily | Conus consors | AOWLVP(gSr)QITTCCGYNOGTMCOSCMCTNTC | |
| P01537 | CMrVIA | Conus marmoreus | VCCGYKLCHOC | ||
| P01738 | CMrX | T superfamily | Conus marmoreus | GICCGVSFCYOC | |
| P05348 | CnID | A superfamily | Conus consors | CCHOACGKHFNC | |
| P05353 | CnIK | Conus consors | NGRCCHOACGKYYSC(nh2) | ||
| P01632 | CnVIIA | O1 superfamily | Conus consors | CKGKGAOCTRL(Mox)YDCCHGSCSSSKGRC(nh2) | |
| P06934 | Con-ins G1 B chain | Insulin superfamily | Conus geographus (Geography cone) | TFDTOKHRCGS(Gla)ITNSYMDLCYR | |
| P06937 | Con-ins G3 A chain | Insulin superfamily | Conus geographus (Geography cone) | GIV(Gla)VCCDNOCTVATLRTFCH | |
| P08527 | Conkunitzin-C1 | Conus catus | DRPSYCNLOADSGSGTNREQRIYYNSARKQCLTFPYKGKGG NANNFSRTNDCRRTCQYPAA |
||
| P08991 | Conomarphin Eu1 | Conus eburneus | GWVYHAHPEONSfWT | ||
| P08909 | conomarphin-Ac1 | M superfamily | Conus achatinus | NYYLYOAROENSwwT | |
| P08910 | conomarphin-Ac1[O6P] | M superfamily | Conus achatinus | NYYLYPAROENSwwT | |
| P02835 | conomarphin-Mr1 | M superfamily | Conus marmoreus | DWEYHAHPKONSfWT | |
| P05440 | conomarphin-Mr2 | M superfamily | Conus marmoreus | DWVNHAHOQONSIWS | |
| P02481 | Conophan-mus-V | Conus mus | SOANS(hVa)WS | ||
| P10035 | Conopressin Ba1 | Conus bayani | CYITNCORG(nh2) | ||
| P03726 | conopressin-Tx | Conus textile (Cloth-of-gold cone) | CFIRNCPO | ||
| P01268 | conotoxin-GS | O1 superfamily | Conus geographus (Geography cone) | ACSGRGSRCOOQCCMGLRCGRGNPQKCIGAH(Gla)DV | |
| P09801 | Contryphan Eu1 | Conus eburneus | GCOPGLWC(nh2) | ||
| P01270 | Contryphan-Am | O2 superfamily | Conus amadis | GCOwDPWC(nh2) | |
| P08776 | Contryphan-Be | Conus betulinus | VVGCOwQPWC(nh2) | ||
| P08777 | Contryphan-Fi | Conus figulinus | VVGCOwQPWC(nh2) | ||
| P06830 | Contryphan-Fia | Conus figulinus | GCODWQPWC | ||
| P06828 | Contryphan-Fib | Conus figulinus | GCOWMPWC(nh2) | ||
| P09757 | Contryphan-Fr1 | O2 superfamily | Conus frigidus | GCOwDPWC(nh2) | |
| P09767 | Contryphan-Fr2 | O2 superfamily | Conus frigidus | GCOwDSWC(nh2) | |
| P10518 | Contryphan-In3 | Conus inscriptus | CVLYOWC(nh2) | ||
| P01372 | Contryphan-R | O2 superfamily | Conus radiatus | GCOwEP(Btr)C(nh2) | |
| P03549 | Contryphan-S | O2 superfamily | Conus striatus (Striated cone) | GCOwEPWC(nh2) | |
| P01318 | Contryphan-Sm | O2 superfamily | Conus stercusmuscarum | GCOwQPWC(nh2) | |
| P02622 | Contryphan-Tx | O2 superfamily | Conus textile (Cloth-of-gold cone) | GCOwQPYC(nh2) | |
| P07557 | Contryphan-Ze | Conus zeylanicus | VVGCOwQPWC(nh2) | ||
| P02550 | De13a | Conus delessertii | DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG CTH(nh2) |
||
| P03629 | De7b | Conus delessertii | DCIOGG(Gla)NCDVFROYRCCSGYCILLLCA | ||
| P01496 | DeVIIA | O1 superfamily | Conus delessertii | ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2) | |
| P02843 | Di19A | Divergent MSTLGMTLL- | Conus distans | GCDOTDGCQTTVC(Gla)TDTGOCCCKPNFTCQISNSGTKS CSCSGQOSDCOV |
|
| P00050 | EI | A superfamily | Conus ermineus (Atlantic fish-hunting cone) | RDOCCYHPTCNMSNPQIC(nh2) | |
| P04069 | EIIA | A superfamily | Conus ermineus (Atlantic fish-hunting cone) | ZTOGCCWNPACVKNRC(nh2) | |
| P07538 | EIIB | Conus ermineus (Atlantic fish-hunting cone) | ZTOGCCWHPACGKNRC(nh2) | ||
| P01635 | EIVA | Conus ermineus (Atlantic fish-hunting cone) | GCCGPYONAACHOCGCKVGROOYCDROSGG(nh2) | ||
| P01740 | EIVB | Conus ermineus (Atlantic fish-hunting cone) | GCCGKYONAACHOCGCTVGROOYCDROSGG(nh2) | ||
| P01561 | EVIA | O1 superfamily | Conus ermineus (Atlantic fish-hunting cone) | DDCIKOYGFCSLPILKNGLCCSGACVGVCADL(nh2) | |
| P06824 | Fi3b | M superfamily | Conus figulinus | CCSQDCRVCIOCCPY | |
| P07899 | Fr3.1 | M superfamily | Conus frigidus | ZQ(Gla)CCDODWCDGACYNCC | |
| P00098 | GID | A superfamily | Conus geographus (Geography cone) | IRD(Gla)CCSNPACRVNNOHVC | |
| P01571 | GIIIA | M superfamily | Conus geographus (Geography cone) | RDCCTOOKKCKDRQCKOQRCCA(nh2) | |
| P01566 | GIIIB | M superfamily | Conus geographus (Geography cone) | RDCCTOORKCKDRRCKOMKCCA(nh2) | |
| P01744 | GIIIC | Conus geographus (Geography cone) | RDCCTOOKKCKDRRCKOLKCCA(nh2) | ||
| P01511 | Gla(1)-TxVI | O2 superfamily | Conus textile (Cloth-of-gold cone) | GM(Btr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla) GSCTM(Btr) |
|
| P02845 | Gla(2)-TxVI/A | O2 superfamily | Conus textile (Cloth-of-gold cone) | SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2) | |
| P02846 | Gla(2)-TxVI/B | O2 superfamily | Conus textile (Cloth-of-gold cone) | NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2) | |
| P02847 | Gla(3)-TxVI | O2 superfamily | Conus textile (Cloth-of-gold cone) | LCODYT(Gla)OCSHAH(Gla)CCSWNCYNGHCTG | |
| P01546 | GVIA | O1 superfamily | Conus geographus (Geography cone) | CKSOGSSCSOTSYNCCRSCNOYTKRCY(nh2) | |
| P01743 | GVIIA | O1 superfamily | Conus geographus (Geography cone) | CKSOGTOCSRGMRDCCTSCLLYSNKCRRY | |
| P02581 | GVIIB | Conus geographus (Geography cone) | CKSOGTOCSRGMRDCCTSCLSYSNKCRRY | ||
| P02582 | GVIIIA | S superfamily | Conus geographus (Geography cone) | GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG CACS(nh2) |
|
| P06822 | GVIIJ | O1 superfamily | Conus geographus (Geography cone) | G(Btr)CGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKS SA |
|
| P10519 | In1.1 | Conus inscriptus | EGCCSNPOCRHNHOEVC(nh2) | ||
| P10520 | In1.2 | Conus inscriptus | ZGCCSNPOCRHNHPEVC(nh2) | ||
| P10521 | In1.3 | Conus inscriptus | GCCSHPOCNVNNPHICG(nh2) | ||
| P02625 | LtIIIA | M superfamily | Conus litteratus | D(Gla)CC(Gla)OQWCDGACDCCS | |
| P02527 | MIVA | A superfamily | Conus magus (Magus cone) | AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS COOKRKO(nh2) |
|
| P07647 | MoVIA | O1 superfamily | Conus moncuri | CKPOGSKCSOSMRDCCTTCISYTKRCRKYYN | |
| P07646 | MoVIB | O1 superfamily | Conus moncuri | CKPOGSKCSOSMRDCCTTCISYTKRCRKYY | |
| P05459 | Mr062 | O1 superfamily | Conus marmoreus | CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC AT(Btr)LDL |
|
| P04662 | Mr1.8 | A superfamily | Conus marmoreus | ROECCTHOACHVSNPELCS | |
| P05484 | Mr10.2 | T superfamily | Conus marmoreus | ACCVYKICYOC | |
| P05367 | Mr11.1 | I1 superfamily | Conus marmoreus | DKWGTCSLLGKGCRHHSDCCWDLCCTGKTCVMTVLOCLFLS LIVRWT |
|
| P05487 | Mr15.1 | N superfamily | Conus marmoreus | CSSGKTCGSVEOVLCCARSDCYCRLIQTRSYWVOICVCP | |
| P05489 | Mr15.2 | N superfamily | Conus marmoreus | CRSGKTCORVGODVCC(Gla)RSDCFCKLVOARPFWRYRCI CL |
|
| P05416 | Mr3.11 | M superfamily | Conus marmoreus | CCRIACNLKCNOCC(nh2) | |
| P05380 | Mr6.16 | O2 superfamily | Conus marmoreus | TTAES(Btr)WEGECLGWSNGCTHOSDCCSNYCKGIYCDL | |
| P05495 | Mr6.23 | H superfamily | Conus marmoreus | STDCNGVOCQFGCCVTINGNDECRELDC | |
| P05514 | Mr6.24 | H superfamily | Conus marmoreus | STDCNGVOCEFGCCVTINGNDECREIGCE | |
| P05503 | Mr6.26 | H superfamily | Conus marmoreus | IEEDCGYVOCEFGCCRIIDGKEKCREIDCQ | |
| P01384 | MrIA | T superfamily | Conus marmoreus | NGVCCGYKLCHOC | |
| P01737 | MrIB | T superfamily | Conus marmoreus | VGVCCGYKLCHOC | |
| P01422 | MrIIIA | M superfamily | Conus marmoreus | GCCGSFACRFGCVOCCV | |
| P01465 | MrIIIB | M superfamily | Conus marmoreus | SKQCCHLAACRFGCTOCCW | |
| P01486 | MrIIIC | M superfamily | Conus marmoreus | CCAPSACRLGCROCCR | |
| P02696 | MrIIID | M superfamily | Conus marmoreus | CCRLSCGLGCHOCC(nh2) | |
| P02698 | MrIIIG | M superfamily | Conus marmoreus | DCCOLPACPFGCNOCC(nh2) | |
| P03603 | Ms20.4 | D superfamily | Conus mustelinus | DNE(Gla)ECQINOPGSSWGKCCMTRMCGTMCCARSGCTCV YHWRRGHGCSCPG |
|
| P01624 | MVIA | O1 superfamily | Conus magus (Magus cone) | DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2) | |
| P01519 | NgVIA | Conus nigropunctatus | SKCFSOGTFCGIKOGLCCSVRCFSLFCISFE | ||
| P01397 | OIVA | A superfamily | Conus obscurus | CCGVONAACHOCVCKNTC(nh2) | |
| P01688 | OIVB | A superfamily | Conus obscurus | CCGVONAACPOCVCNKTCG(nh2) | |
| P00038 | PIB | A superfamily | Conus purpurascens | ZSOGCCWNPACVKNRC(nh2) | |
| P08506 | PIC | Conus purpurascens | SGCCKHOACGKNRC | ||
| P01611 | PIIIE | M superfamily | Conus purpurascens | HOOCCLYGKCRRYOGCSSASCCQR(nh2) | |
| P01594 | PIIIF | M superfamily | Conus purpurascens | GOOCCLYGSCROFOGCYNALCCRK(nh2) | |
| P01449 | PIVA | A superfamily | Conus purpurascens | GCCGSYONAACHOCSCKDROSYCGQ(nh2) | |
| P06978 | PiVIIA | Conus princeps (Prince cone) | CDAOTHYCTNYW(Gla)CCSGYC(Gla)HSHCW | ||
| P08998 | PiXXA | D superfamily | Conus princeps (Prince cone) | AVKKTCIRSTOGSNWGRCCLTKMCHTLCCARSDCTCVYRSG KGHGCSCTS |
|
| P01636 | PnVIIA | O2 superfamily | Conus pennaceus | DCTSWFGRCTVNS(Gla)CCSNSCDQTYC(Gla)LYAFOS | |
| P02859 | PrXA | C superfamily | Conus parius | TYGIYDAKPOFSCAGLRGGCVLPONLROKFKE(nh2) | |
| P02595 | PVIA | O1 superfamily | Conus purpurascens | EACYAOGTFCGIKOGLCCSEFCLPGVCFG(nh2) | |
| P01356 | PVIIA | O1 superfamily | Conus purpurascens | CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | |
| P01493 | Reg12e | M superfamily | Conus regius | KCCMRPICTCOCCIGP(nh2) | |
| P01488 | Reg12k | M superfamily | Conus regius | KCCMRPICMCOCCIGAG | |
| P00028 | Reg1b/Reg1c | A superfamily | Conus regius | GCCSDORCKHQC(nh2) | |
| P00031 | Reg1f | A superfamily | Conus regius | DYCCRROOCTLIC(nh2) | |
| P08570 | reg3a | M superfamily | Conus regius | GCCOOQWCGODCTSOCC | |
| P08572 | reg3c | Conus regius | CCAFOQWCGAGCIVOCC | ||
| P08573 | reg3d | Conus regius | LCCOOQOCGODCASOCC | ||
| P08533 | reg3e | Conus regius | KCCMRPICTCOCCIGP | ||
| P08538 | reg3h | Conus regius | GCCSOWNCIQLRACOCCON(nh2) | ||
| P08561 | reg3i | Conus regius | CCAIRLCNVYLCGSCCO | ||
| P08540 | reg3j | Conus regius | GCCSOWNCIQLRACGCC | ||
| P08534 | reg3k | M superfamily | Conus regius | KCCMRPICMCOCCIGP(nh2) | |
| P00030 | RgIA [P6O,del13] | A superfamily | Conus regius | GCCSDORCRYRC(nh2) | |
| P03906 | RIIIJ | Conus radiatus | LOOCCTOOKKHCOAOACKYKOCCKS | ||
| P00840 | RXIA | I1 superfamily | Conus radiatus | GOSFCKADEKOCEYHADCCNCCLSGICAOSTNWILPGCSTS SFfKI |
|
| P00842 | RXIB | I1 superfamily | Conus radiatus | GOSFCKANGKOCSYHADCCNCCLSGICKOSTNVILPGCSTS SFfRI |
|
| P02592 | RXIC | I1 superfamily | Conus radiatus | GOSFCKADEKOCKYHADCCNCCLGGICKOSTSWIGCSTNVF lT |
|
| P00843 | RXID | I1 superfamily | Conus radiatus | GCKKDRKOCSYHADCCNCCLSGICAOSTNWILPGCSTSTFT | |
| P02524 | SIVA | A superfamily | Conus striatus (Striated cone) | ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2) | |
| P02980 | Sm1.1 | A superfamily | Conus stercusmuscarum | GRCCHPACGONYSC(nh2) | |
| P03752 | SrIA | A superfamily | Conus spurius | RTCCSROTCRM(Gla)YP(Gla)LCG(nh2) | |
| P03901 | SrIB | A superfamily | Conus spurius | RTCCSROTCRMEYP(Gla)LCG(nh2) | |
| P01794 | SVIA | O1 superfamily | Conus striatus (Striated cone) | CRSSGSOCGVTSICCGRCYRGKCT(nh2) | |
| P02710 | SVIE | O1 superfamily | Conus striatus (Striated cone) | DGCSSGGTFCGIHOGLCCSEFCFLWCITFID | |
| P01405 | TVIIA | O1 superfamily | Conus tulipa (tulip cone) | SCSGRDSRCOOVCCMGLMCSRGKCVSIYGE | |
| P02883 | Tx1.2 | A superfamily | Conus textile (Cloth-of-gold cone) | ROQCCSHOACNVDHPEIC | |
| P03755 | Tx10b | Conus textile (Cloth-of-gold cone) | DPCCGYRMCVOC(nh2) | ||
| P03754 | Tx10c | Conus textile (Cloth-of-gold cone) | ZTCCGYRMCVOC(nh2) | ||
| P03749 | Tx3e | Conus textile (Cloth-of-gold cone) | SCCNAGFCRFGCTOCCY | ||
| P05831 | Tx3i | Conus textile (Cloth-of-gold cone) | CCGOTACLAGCKPCC(nh2) | ||
| P05834 | Tx3j | Conus textile (Cloth-of-gold cone) | CCDDSECSTSCWOCCY | ||
| P05835 | Tx6.5 | Conus textile (Cloth-of-gold cone) | NCPYCVVYCCPOAYCQASGCRPP | ||
| P05832 | TxIC | T superfamily | Conus textile (Cloth-of-gold cone) | DKQTCCGYRMCVOC(nh2) | |
| P02562 | TxIIIC | M superfamily | Conus textile (Cloth-of-gold cone) | CCRTCFGCTOCC(nh2) | |
| P03212 | TxMEKL-P2 | O2 superfamily | Conus textile (Cloth-of-gold cone) | DCRGYDAOCSSGAPCCD(Btr)(Btr)TCSARTNRCF | |
| P03156 | TxMMSK-03 | M superfamily | Conus textile (Cloth-of-gold cone) | CCNAGFCRFGCTOCCY | |
| P02556 | TxO4 | O1 superfamily | Conus textile (Cloth-of-gold cone) | YDCEPPGNFCGMIKIGPOCCSG(Btr)CFFACA | |
| P01543 | TxVA | T superfamily | Conus textile (Cloth-of-gold cone) | (Gla)CC(Gla)DG(Btr)CC(gTr)AAO | |
| P02539 | VcIA | A superfamily | Conus victoriae | GCCSDORCNYDHP(Gla)IC(nh2) | |
| P02540 | VcVA | T superfamily | Conus victoriae | CCPGKOCCRI(nh2) | |
| P02649 | Vi6.1 | O1 superfamily | Conus virgo | DCGGQGEGCYTQOCCOGLRCRGGGTGGGVCQL | |
| P01686 | VxXXA | D superfamily | Conus vexillum | DVQDCQVSTOGSKWGRCCLNRVCGPMCCPASHCYCVYHRGR GHGCSC |
Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6
ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.
The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).
Contacts:
David Craik
Quentin Kaas
Last updated: Saturday 30 September 2023