ID | Name | Gene superfamily | Organism | Sequence | |
---|---|---|---|---|---|
P04343 | Ac-L1 | synthetic construct | (Ac)LOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P08391 | Am1.5 | A superfamily | Conus amadis | ROECCSHOACNVDHOEIC | |
P08407 | Am6.6 | O2 superfamily | Conus amadis | GCTWWFGRCAEDGECCSNSCDQTYCELYAFOS | |
P04230 | Ar1248 | Conus araneosus | GVCCGVSFCYOC | ||
P04229 | Ar1311 | Conus araneosus | RCCGYKMCHOC | ||
P04232 | Ar1446 | Conus araneosus | CCRLACGLGCHOCC(nh2) | ||
P05524 | As25a | Conus austini | CKCOSCNFNDVTENCKCCIFRQO(nh2) | ||
P01628 | AVIA | O1 superfamily | Conus aurisiacus | DGCSNAGAFCGIHOGLCCSEICIVWCT | |
P10045 | Ba6.1 | U superfamily | Conus bayani | SSQSTCOYCQISCCOOAYCQOSGCRGP | |
P10041 | Ba9.1 | P superfamily | Conus bayani | VSCG(Gla)YCGDYGDCOSSCOTCTSNLLKCM | |
P03551 | Bromocontryphan-S | Conus striatus (Striated cone) | GCO(Btr)EPWC(nh2) | ||
P01811 | Bromosleeper peptide | O3 superfamily | Conus radiatus | (Btr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW QCV(Gla)ACPV |
|
P07497 | Bru9a | Conus brunneus | SCGGSCFGGCWOGCSCYARTCFRD | ||
P07498 | Bru9a-GLP cyclic | synthetic construct | SCGGSCFGGCWOGCSCYARTCFRDGLP | ||
P02526 | BtX | I2 superfamily | Conus betulinus | CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR HP(nh2) |
|
P04590 | Bu27 | Conus bullatus | AO(Gla)LVVTATTTCCGYDOMTICOOCMCTHSCOOKRKO(nh2) | ||
P05869 | BuIA[P6O] | synthetic construct | GCCSTOPCAVLYC(nh2) | ||
P05870 | BuIA[P7O] | synthetic construct | GCCSTPOCAVLYC(nh2) | ||
P09954 | BuIA[T5A,P6O] | Conus bullatus | GCCSAOPCAVLYCG(nh2) | ||
P01627 | BVIA | O1 superfamily | Conus bullatus | DECSAOGAFCLIROGLCCSEFCFFACF | |
P04080 | C4.1 | A superfamily | Conus catus | QKELVPSTITTCCGNEPGTMCPKCMCDNTCOPKKKKRP | |
P03087 | C6.1 | O1 superfamily | Conus catus | YGCSNAGAFCGIHOGLCCSELCLGWCT | |
P09974 | C6.2 | O1 superfamily | Conus catus | DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2) | |
P08523 | C8.4 | S superfamily | Conus catus | ZYPLGCOGTCGKGGKCVGTCECTNYTNCYCSSKGFREPGCS CTCPT |
|
P02825 | Ca15a | O2 superfamily | Conus caracteristicus (characteristic cone) | CRVENKCOHTVCCDRSRCSCKLIRTRPLMYHVCVC | |
P04136 | Cal5.1 L1a | Divergent MRFYIGLMAA | Conus californicus | DAADVKOVARTNEGOGRDOAOCCQHPIETCC | |
P04260 | Cal5.1 L1b | Divergent MRFYIGLMAA | Conus californicus | TNEGOGRDOAOCCQHPIETCC | |
P04261 | Cal5.1 L2a | Divergent MRFYIGLMAA | Conus californicus | DAADVKOVARQNEGOGRDOAOCCQHPIETCC | |
P04262 | Cal5.1 L2b | Divergent MRFYIGLMAA | Conus californicus | QNEGOGRDOAOCCQHPIETCC | |
P04263 | Cal5.1 L3a | Divergent MRFYIGLMAA | Conus californicus | DAADVKOVARHNDGOGRDOAOCCQHPIETCC | |
P04264 | Cal5.1 L3b | Divergent MRFYIGLMAA | Conus californicus | HNDGOGRDOAOCCQHPIETCC | |
P04920 | Cal6.17b | Conus californicus | GDACSLLNGDDCGOGELCCTOSGDHQGTCETSCW | ||
P04265 | Cal6.4c | O1 superfamily | Conus californicus | GC(Btr)LCLGONACCRGSVCHDYCPS | |
P04922 | Cal9.8 | Conus californicus | DDETTFPCNSGRCACLOEDSHSYTCQSO | ||
P04916 | CalTx-2 | Conus californicus | SLCDKOHHNCIDGQTCYHTCCQNGLKCVRYO | ||
P04917 | CalXXIXA | Conus californicus | ROKCCCVCGVVGRKCCSTWDKCHOVHLOCOSS(nh2) | ||
P02840 | CaXVIIA | Y superfamily | Conus caracteristicus (characteristic cone) | CGGTGDSCNEOAGELCCRRLKCVNSRCCPTTDGC | |
P01510 | CcTx | A superfamily | Conus consors | AOWLVP(gSr)QITTCCGYNOGTMCOSCMCTNTC | |
P01537 | CMrVIA | Conus marmoreus | VCCGYKLCHOC | ||
P02854 | CMrVIA [K6P] | synthetic construct | VCCGYPLCHOC | ||
P02855 | CMrVIA [K6P] amidated | synthetic construct | VCCGYPLCHOC(nh2) | ||
P02856 | CMrVIA amidated | synthetic construct | VCCGYKLCHOC(nh2) | ||
P01738 | CMrX | T superfamily | Conus marmoreus | GICCGVSFCYOC | |
P05348 | CnID | A superfamily | Conus consors | CCHOACGKHFNC | |
P05353 | CnIK | Conus consors | NGRCCHOACGKYYSC(nh2) | ||
P03996 | CnVIB | Conus consors | DECFSOGTFCGTKOGLCCSARCFSFFCISLEF(nh2) | ||
P03997 | CnVIC | Conus consors | DECFSOGTFCGIKOGLCCSARCFSFFCISLEF(nh2) | ||
P03998 | CnVID | Conus consors | DECFSOGTFCGFKOGLCCSARCFSFFCISLEF(nh2) | ||
P01632 | CnVIIA | O1 superfamily | Conus consors | CKGKGAOCTRL(Mox)YDCCHGSCSSSKGRC(nh2) | |
P05232 | CnVIIC | O1 superfamily | Conus consors | CKGTGKOCSRIAYNCCTGSCRSGKC(nh2) | |
P06934 | Con-ins G1 B chain | Insulin superfamily | Conus geographus (Geography cone) | TFDTOKHRCGS(Gla)ITNSYMDLCYR | |
P06937 | Con-ins G3 A chain | Insulin superfamily | Conus geographus (Geography cone) | GIV(Gla)VCCDNOCTVATLRTFCH | |
P07643 | conantokin-G[+10O] | synthetic construct | GE(Gla)(Gla)LQ(Gla)NQO(Gla)LIR(Gla)KSN(nh2) | ||
P05841 | Conantokin-Rl2 | B1 superfamily | Conus rolani | GE(Gla)(Gla)LA(Gla)KAO(Gla)FAR(Gla)LAN(nh2) | |
P05847 | Conantokin-Rl2[K8Nle] | synthetic construct | GE(Gla)(Gla)LA(Gla)(Nle)AO(Gla)FAR(Gla)LA N(nh2) |
||
P05844 | Conantokin-Rl2[L5Y] | synthetic construct | GE(Gla)(Gla)YA(Gla)KAO(Gla)FAR(Gla)LAN(nh2) | ||
P08527 | Conkunitzin-C1 | Conus catus | DRPSYCNLOADSGSGTNREQRIYYNSARKQCLTFPYKGKGG NANNFSRTNDCRRTCQYPAA |
||
P08996 | Conomarphin Eb1[f13A] | synthetic construct | GWVYHAHPEONSAWT | ||
P08997 | Conomarphin Eb1[f13F] | synthetic construct | GWVYHAHPEONSFWT | ||
P08991 | Conomarphin Eu1 | Conus eburneus | GWVYHAHPEONSfWT | ||
P08909 | conomarphin-Ac1 | M superfamily | Conus achatinus | NYYLYOAROENSwwT | |
P08923 | conomarphin-Ac1 amidated | synthetic construct | NYYLYOAROENSwwT(nh2) | ||
P08925 | conomarphin-Ac1[E10(Gla), W14(Gla)] | synthetic construct | NYYLYOARO(Gla)NSw(Gla)T | ||
P08926 | conomarphin-Ac1[E10(Gla), W14(Gla)] amidated | synthetic construct | NYYLYOARO(Gla)NSw(Gla)T(nh2) | ||
P08924 | conomarphin-Ac1[E10(Gla)] | synthetic construct | NYYLYOARO(Gla)NSwwT | ||
P08917 | conomarphin-Ac1[E10A] | synthetic construct | NYYLYOAROANSwwT | ||
P08914 | conomarphin-Ac1[L4A] | synthetic construct | NYYAYOAROENSwwT | ||
P08919 | conomarphin-Ac1[N11A] | synthetic construct | NYYLYOAROEASwwT | ||
P08911 | conomarphin-Ac1[N1A] | synthetic construct | AYYLYOAROENSwwT | ||
P08916 | conomarphin-Ac1[O6A] | synthetic construct | NYYLYAAROENSwwT | ||
P08910 | conomarphin-Ac1[O6P] | M superfamily | Conus achatinus | NYYLYPAROENSwwT | |
P08918 | conomarphin-Ac1[O9A] | synthetic construct | NYYLYOARAENSwwT | ||
P08928 | conomarphin-Ac1[R8A] | synthetic construct | NYYLYOAAOENSwwT | ||
P08920 | conomarphin-Ac1[S12A] | synthetic construct | NYYLYOAROENAwwT | ||
P08915 | conomarphin-Ac1[T15A] | synthetic construct | NYYLYOAROENSwwA | ||
P08921 | conomarphin-Ac1[W13A] | synthetic construct | NYYLYOAROENSAwT | ||
P08922 | conomarphin-Ac1[W14A] | synthetic construct | NYYLYOAROENSwAT | ||
P08913 | conomarphin-Ac1[Y2A] | synthetic construct | NAYLYOAROENSwwT | ||
P08912 | conomarphin-Ac1[Y3A] | synthetic construct | NYALYOAROENSwwT | ||
P08927 | conomarphin-Ac1[Y5A] | synthetic construct | NYYLAOAROENSwwT | ||
P04218 | Conomarphin-Im1 | M superfamily | Conus imperialis | DWEYHAHPKONSfWT | |
P02835 | conomarphin-Mr1 | M superfamily | Conus marmoreus | DWEYHAHPKONSfWT | |
P05440 | conomarphin-Mr2 | M superfamily | Conus marmoreus | DWVNHAHOQONSIWS | |
P02481 | Conophan-mus-V | Conus mus | SOANS(hVa)WS | ||
P10035 | Conopressin Ba1 | Conus bayani | CYITNCORG(nh2) | ||
P03726 | conopressin-Tx | Conus textile (Cloth-of-gold cone) | CFIRNCPO | ||
P01268 | conotoxin-GS | O1 superfamily | Conus geographus (Geography cone) | ACSGRGSRCOOQCCMGLRCGRGNPQKCIGAH(Gla)DV | |
P09801 | Contryphan Eu1 | Conus eburneus | GCOPGLWC(nh2) | ||
P01270 | Contryphan-Am | O2 superfamily | Conus amadis | GCOwDPWC(nh2) | |
P08776 | Contryphan-Be | Conus betulinus | VVGCOwQPWC(nh2) | ||
P04624 | Contryphan-Bu | O2 superfamily | Conus bullatus | KCOwSPWC(nh2) | |
P08777 | Contryphan-Fi | Conus figulinus | VVGCOwQPWC(nh2) | ||
P06830 | Contryphan-Fia | Conus figulinus | GCODWQPWC | ||
P06828 | Contryphan-Fib | Conus figulinus | GCOWMPWC(nh2) | ||
P09757 | Contryphan-Fr1 | O2 superfamily | Conus frigidus | GCOwDPWC(nh2) | |
P09767 | Contryphan-Fr2 | O2 superfamily | Conus frigidus | GCOwDSWC(nh2) | |
P10518 | Contryphan-In3 | Conus inscriptus | CVLYOWC(nh2) | ||
P02621 | Contryphan-Lt1 | O2 superfamily | Conus litteratus | GCOwEPWC(nh2) | |
P02597 | Contryphan-P | O2 superfamily | Conus purpurascens | GCOwDPWC(nh2) | |
P01372 | Contryphan-R | O2 superfamily | Conus radiatus | GCOwEP(Btr)C(nh2) | |
P01355 | Contryphan-R [Des-Gly1] | synthetic construct | COwQPWC(nh2) | ||
P03549 | Contryphan-S | O2 superfamily | Conus striatus (Striated cone) | GCOwEPWC(nh2) | |
P01318 | Contryphan-Sm | O2 superfamily | Conus stercusmuscarum | GCOwQPWC(nh2) | |
P02622 | Contryphan-Tx | O2 superfamily | Conus textile (Cloth-of-gold cone) | GCOwQPYC(nh2) | |
P07557 | Contryphan-Ze | Conus zeylanicus | VVGCOwQPWC(nh2) | ||
P03591 | Cp20.3 | D superfamily | Conus capitaneus | (Gla)VQ(Gla)CQVDTOGSSWGKCCMTRMCGTMCCSRSVC TCVYHWRRGHGCSCPG |
|
P03595 | Cp20.5 | D superfamily | Conus capitaneus | DNEA(Gla)CQIDTOGSSWGKCCMTRMCGTMCCSRSVCTCV YHWRRGHGCSCPG |
|
P01625 | CVIE-2 | O1 superfamily | Conus catus | YGCSNAGAFCGIHOGLCCSELCLVWCT | |
P01262 | Cyclic contryphan | synthetic construct | GCOyNPKC(nh2) | ||
P02848 | Cyclic MrIA | synthetic construct | NGVCCGYKLCHOCAG | ||
P02550 | De13a | Conus delessertii | DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG CTH(nh2) |
||
P05522 | De13b | G superfamily | Conus delessertii | DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVRQHCSGCNH(nh2) | |
P03629 | De7b | Conus delessertii | DCIOGG(Gla)NCDVFROYRCCSGYCILLLCA | ||
P01496 | DeVIIA | O1 superfamily | Conus delessertii | ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2) | |
P02843 | Di19A | Divergent MSTLGMTLL- | Conus distans | GCDOTDGCQTTVC(Gla)TDTGOCCCKPNFTCQISNSGTKS CSCSGQOSDCOV |
|
P00050 | EI | A superfamily | Conus ermineus (Atlantic fish-hunting cone) | RDOCCYHPTCNMSNPQIC(nh2) | |
P09022 | EI[D2A] | synthetic construct | RAOCCYHPTCNMSNPQIC(nh2) | ||
P09036 | EI[del1-2] | synthetic construct | OCCYHPTCNMSNPQIC(nh2) | ||
P09035 | EI[del1] | synthetic construct | DOCCYHPTCNMSNPQIC(nh2) | ||
P09025 | EI[H7A] | synthetic construct | RDOCCYAPTCNMSNPQIC(nh2) | ||
P09034 | EI[I17A] | synthetic construct | RDOCCYHPTCNMSNPQAC(nh2) | ||
P09029 | EI[M12A] | synthetic construct | RDOCCYHPTCNASNPQIC(nh2) | ||
P09028 | EI[N11A] | synthetic construct | RDOCCYHPTCAMSNPQIC(nh2) | ||
P09031 | EI[N14A] | synthetic construct | RDOCCYHPTCNMSAPQIC(nh2) | ||
P09032 | EI[P15A] | synthetic construct | RDOCCYHPTCNMSNAQIC(nh2) | ||
P09026 | EI[P8A] | synthetic construct | RDOCCYHATCNMSNPQIC(nh2) | ||
P09033 | EI[Q16A] | synthetic construct | RDOCCYHPTCNMSNPAIC(nh2) | ||
P09021 | EI[R1A] | synthetic construct | ADOCCYHPTCNMSNPQIC(nh2) | ||
P09030 | EI[S13A] | synthetic construct | RDOCCYHPTCNMANPQIC(nh2) | ||
P09027 | EI[T9A] | synthetic construct | RDOCCYHPACNMSNPQIC(nh2) | ||
P09024 | EI[Y6A] | synthetic construct | RDOCCAHPTCNMSNPQIC(nh2) | ||
P04069 | EIIA | A superfamily | Conus ermineus (Atlantic fish-hunting cone) | ZTOGCCWNPACVKNRC(nh2) | |
P07538 | EIIB | Conus ermineus (Atlantic fish-hunting cone) | ZTOGCCWHPACGKNRC(nh2) | ||
P01635 | EIVA | Conus ermineus (Atlantic fish-hunting cone) | GCCGPYONAACHOCGCKVGROOYCDROSGG(nh2) | ||
P01740 | EIVB | Conus ermineus (Atlantic fish-hunting cone) | GCCGKYONAACHOCGCTVGROOYCDROSGG(nh2) | ||
P01561 | EVIA | O1 superfamily | Conus ermineus (Atlantic fish-hunting cone) | DDCIKOYGFCSLPILKNGLCCSGACVGVCADL(nh2) | |
P01575 | EVIB | O1 superfamily | Conus ermineus (Atlantic fish-hunting cone) | EACYOOGTFCGIKOGLCCSELCLPAVCVG(nh2) | |
P06824 | Fi3b | M superfamily | Conus figulinus | CCSQDCRVCIOCCPY | |
P07899 | Fr3.1 | M superfamily | Conus frigidus | ZQ(Gla)CCDODWCDGACYNCC | |
P00098 | GID | A superfamily | Conus geographus (Geography cone) | IRD(Gla)CCSNPACRVNNOHVC | |
P03561 | GID [(Gla)4A] | synthetic construct | IRDACCSNPACRVNNOHVC | ||
P08779 | GID [(Gla)4E, A10Q] | synthetic construct | IRDECCSNPQCRVNNOHVC | ||
P07544 | GID [(Gla)4E, A10S] | synthetic construct | IRDECCSNPSCRVNNOHVC | ||
P07545 | GID [(Gla)4E, A10T] | synthetic construct | IRDECCSNPTCRVNNOHVC | ||
P07502 | GID [(Gla)4E, A10V] | synthetic construct | IRDECCSNPVCRVNNOHVC | ||
P07553 | GID [(Gla)4E, N15H] | synthetic construct | IRDECCSNPACRVNHOHVC | ||
P07552 | GID [(Gla)4E, N15K] | synthetic construct | IRDECCSNPACRVNKOHVC | ||
P10454 | GID [(Gla)4E, ribbon] | synthetic construct | IRDECCSNPACRVNNOHVC | ||
P07546 | GID [(Gla)4E, V13F] | synthetic construct | IRDECCSNPACRFNNOHVC | ||
P07549 | GID [(Gla)4E, V13I] | synthetic construct | IRDECCSNPACRINNOHVC | ||
P08780 | GID [(Gla)4E, V13I] | synthetic construct | IRDECCSNPACRINNOHVC | ||
P07548 | GID [(Gla)4E, V13L] | synthetic construct | IRDECCSNPACRLNNOHVC | ||
P07550 | GID [(Gla)4E, V13S] | synthetic construct | IRDECCSNPACRSNNOHVC | ||
P07551 | GID [(Gla)4E, V13T] | synthetic construct | IRDECCSNPACRTNNOHVC | ||
P07547 | GID [(Gla)4E, V13W] | synthetic construct | IRDECCSNPACRWNNOHVC | ||
P07503 | GID [(Gla)4E, V13Y] | synthetic construct | IRDECCSNPACRYNNOHVC | ||
P07556 | GID [(Gla)4E, V18N] | synthetic construct | IRDECCSNPACRVNNOHNC | ||
P07555 | GID [(Gla)4E, V18Q] | synthetic construct | IRDECCSNPACRVNNOHQC | ||
P07554 | GID [(Gla)4E, V18Y] | synthetic construct | IRDECCSNPACRVNNOHYC | ||
P03553 | GID [(Gla)4E] | synthetic construct | IRDECCSNPACRVNNOHVC | ||
P07542 | GID [(Gla)4Q] | synthetic construct | IRDQCCSNPACRVNNOHVC | ||
P03560 | GID [D3A,(Gla)4E] | synthetic construct | IRAECCSNPACRVNNOHVC | ||
P07541 | GID [D3N, (Gla)4E] | synthetic construct | IRNECCSNPACRVNNOHVC | ||
P07543 | GID [D3N,E4Q] | synthetic construct | IRNQCCSNPACRVNNOHVC | ||
P03558 | GID [I1A, (Gla)4E] | synthetic construct | ARDECCSNPACRVNNOHVC | ||
P04481 | GID [R12A] | synthetic construct | IRD(Gla)CCSNPACAVNNOHVC | ||
P03559 | GID [R2A, (Gla)4E] | synthetic construct | IADECCSNPACRVNNOHVC | ||
P07540 | GID [R2K, (Gla)4E] | synthetic construct | IKDECCSNPACRVNNOHVC | ||
P03557 | GID amidated [(GLA)4E] | synthetic construct | IRDECCSNPACRVNNOHVC(nh2) | ||
P03571 | GID[(GLA)4E, H17A] | synthetic construct | IRDECCSNPACRVNNOAVC | ||
P03567 | GID[(GLA)4E, N14A] | synthetic construct | IRDECCSNPACRVANOHVC | ||
P03568 | GID[(GLA)4E, N15A] | synthetic construct | IRDECCSNPACRVNAOHVC | ||
P03563 | GID[(GLA)4E, N8A] | synthetic construct | IRDECCSAPACRVNNOHVC | ||
P03564 | GID[(GLA)4E, P9A] | synthetic construct | IRDECCSNAACRVNNOHVC | ||
P03562 | GID[(GLA)4E, S7A] | synthetic construct | IRDECCANPACRVNNOHVC | ||
P03566 | GID[(GLA)4E, V13A] | synthetic construct | IRDECCSNPACRANNOHVC | ||
P03572 | GID[(GLA)4E, V18A] | synthetic construct | IRDECCSNPACRVNNOHAC | ||
P03573 | GID[del1, R2A, (GLA)4E] | synthetic construct | ADECCSNPACRVNNOHVC | ||
P03574 | GID[Del1-2,D3A, (GLA)4E] | synthetic construct | AECCSNPACRVNNOHVC | ||
P03576 | GID[Del1-3, (GLA)4A] | synthetic construct | ACCSNPACRVNNOHVC | ||
P03575 | GID[Del1-3, (GLA)4E] | synthetic construct | ECCSNPACRVNNOHVC | ||
P03577 | GID[Del4] | synthetic construct | CCSNPACRVNNOHVC | ||
P03565 | GID[R12A] | synthetic construct | IRD(Gla)CCSNPACRVNNOHVC | ||
P01571 | GIIIA | M superfamily | Conus geographus (Geography cone) | RDCCTOOKKCKDRQCKOQRCCA(nh2) | |
P07484 | GIIIA [A10C, A21C] | M superfamily | Conus geographus (Geography cone) | RDCCTOOKKAKDRQCKOQRCAA(nh2) | |
P07486 | GIIIA [A3C,A10C,A15C,A21C] | M superfamily | Conus geographus (Geography cone) | RDACTOOKKAKDRQAKOQRCAA(nh2) | |
P07488 | GIIIA [A3C,A4C,A10C,A15C,A20C,A21C] | M superfamily | Conus geographus (Geography cone) | RDAATOOKKAKDRQAKOQRAAA(nh2) | |
P07485 | GIIIA [A3C,A4C,A15C,A20C] | M superfamily | Conus geographus (Geography cone) | RDAATOOKKCKDRQAKOQRACA(nh2) | |
P07482 | GIIIA [A3C] | M superfamily | Conus geographus (Geography cone) | RDACTOOKKCKDRQAKOQRCCA(nh2) | |
P07487 | GIIIA [A4C,A10C,A20C,A21C] | M superfamily | Conus geographus (Geography cone) | RDCATOOKKAKDRQCKOQRAAA(nh2) | |
P07483 | GIIIA [A4C,C20A] | M superfamily | Conus geographus (Geography cone) | RDCATOOKKCKDRQCKOQRACA(nh2) | |
P01570 | GIIIA [R13A] | synthetic construct | RDCCTOOKKCKDAQCKOQRCCA(nh2) | ||
P01566 | GIIIB | M superfamily | Conus geographus (Geography cone) | RDCCTOORKCKDRRCKOMKCCA(nh2) | |
P01744 | GIIIC | Conus geographus (Geography cone) | RDCCTOOKKCKDRRCKOLKCCA(nh2) | ||
P01511 | Gla(1)-TxVI | O2 superfamily | Conus textile (Cloth-of-gold cone) | GM(Btr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla) GSCTM(Btr) |
|
P02845 | Gla(2)-TxVI/A | O2 superfamily | Conus textile (Cloth-of-gold cone) | SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2) | |
P02846 | Gla(2)-TxVI/B | O2 superfamily | Conus textile (Cloth-of-gold cone) | NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2) | |
P02847 | Gla(3)-TxVI | O2 superfamily | Conus textile (Cloth-of-gold cone) | LCODYT(Gla)OCSHAH(Gla)CCSWNCYNGHCTG | |
P01546 | GVIA | O1 superfamily | Conus geographus (Geography cone) | CKSOGSSCSOTSYNCCRSCNOYTKRCY(nh2) | |
P01780 | GVIA [O10>K] | synthetic construct | CKSOGSSCSKTSYNCCRSCNOYTKRCY(nh2) | ||
P05701 | GVIA[C8U,C19U] | synthetic construct | CKSOGSSUSOTSYNCCRSUNOYTKRCY(nh2) | ||
P01743 | GVIIA | O1 superfamily | Conus geographus (Geography cone) | CKSOGTOCSRGMRDCCTSCLLYSNKCRRY | |
P02581 | GVIIB | Conus geographus (Geography cone) | CKSOGTOCSRGMRDCCTSCLSYSNKCRRY | ||
P02582 | GVIIIA | S superfamily | Conus geographus (Geography cone) | GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG CACS(nh2) |
|
P06822 | GVIIJ | O1 superfamily | Conus geographus (Geography cone) | G(Btr)CGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKS SA |
|
P06955 | GVIIJ covalent dimer | synthetic construct | GWCGDOGATCGKLRLYCCSGFCDCYTKTCKDKSSA | ||
P08797 | GVIIJ[(Btr)2A,(Scc)24(Eac)] | synthetic construct | GACGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKDKSSA | ||
P08818 | GVIIJ[(Btr)2W,(Scc)24(Eac),D31K] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKKKSSA | ||
P08814 | GVIIJ[(Btr)2W,(Scc)24(Eac),K27D] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Eac)YTDTCKDKSSA | ||
P08816 | GVIIJ[(Btr)2W,(Scc)24(Eac),K27F] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Eac)YTFTCKDKSSA | ||
P08815 | GVIIJ[(Btr)2W,(Scc)24(Eac),K27G] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Eac)YTGTCKDKSSA | ||
P08819 | GVIIJ[(Btr)2W,(Scc)24(Eac),K32D] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKDDSSA | ||
P08810 | GVIIJ[(Btr)2W,(Scc)24(Eac),Y25A] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Eac)ATKTCKDKSSA | ||
P08812 | GVIIJ[(Btr)2W,(Scc)24(Eac),Y25D] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Eac)DTKTCKDKSSA | ||
P08811 | GVIIJ[(Btr)2W,(Scc)24(Eac),Y25R] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Eac)RTKTCKDKSSA | ||
P06951 | GVIIJ[(Btr)2W,(Scc)24(Eac)] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKDKSSA | ||
P06954 | GVIIJ[(Btr)2W,(Scc)24(Msc)] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Msc)YTKTCKDKSSA | ||
P06834 | GVIIJ[(Btr)2W,(Scc)24(Sgc)] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Sgc)YTKTCKDKSSA | ||
P06953 | GVIIJ[(Btr)2W,(Scc)24(Smtc)] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Smtc)YTKTCKDKSSA | ||
P06952 | GVIIJ[(Btr)2W,(Scc)24(Tcc)] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCD(Tcc)YTKTCKDKSSA | ||
P08813 | GVIIJ[(Btr)2W,(Scc)24C,T26A] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCDCYAKTCKDKSSA | ||
P08817 | GVIIJ[(Btr)2W,(Scc)24C,T28A] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCDCYTKACKDKSSA | ||
P06833 | GVIIJ[(Btr)2W,(Scc)24C] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCDCYTKTCKDKSSA | ||
P06956 | GVIIJ[(Btr)2W,(Scc)24S] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCDSYTKTCKDKSSA | ||
P08808 | GVIIJ[(Btr)2W,D23(Gla),(Scc)24(Eac)] | synthetic construct | GWCGDOGATCGKLRLYCCSGFC(Gla)(Eac)YTKTCKDKS SA |
||
P08809 | GVIIJ[(Btr)2W,D23N,(Scc)24(Eac)] | synthetic construct | GWCGDOGATCGKLRLYCCSGFCN(Eac)YTKTCKDKSSA | ||
P08798 | GVIIJ[(Btr)2W,D5K,(Scc)24(Eac)] | synthetic construct | GWCGKOGATCGKLRLYCCSGFCD(Eac)YTKTCKDKSSA | ||
P08807 | GVIIJ[(Btr)2W,F21A,(Scc)24C] | synthetic construct | GWCGDOGATCGKLRLYCCSGACDCYTKTCKDKSSA | ||
P08801 | GVIIJ[(Btr)2W,K12D,(Scc)24(Eac)] | synthetic construct | GWCGDOGATCGDLRLYCCSGFCD(Eac)YTKTCKDKSSA | ||
P08802 | GVIIJ[(Btr)2W,L13A,(Scc)24(Eac)] | synthetic construct | GWCGDOGATCGKARLYCCSGFCD(Eac)YTKTCKDKSSA | ||
P08804 | GVIIJ[(Btr)2W,L15A,(Scc)24(Eac)] | synthetic construct | GWCGDOGATCGKLRAYCCSGFCD(Eac)YTKTCKDKSSA | ||
P08803 | GVIIJ[(Btr)2W,R14D,(Scc)24(Eac)] | synthetic construct | GWCGDOGATCGKLDLYCCSGFCD(Eac)YTKTCKDKSSA | ||
P08806 | GVIIJ[(Btr)2W,S19A,(Scc)24(Eac)] | synthetic construct | GWCGDOGATCGKLRLYCCAGFCD(Eac)YTKTCKDKSSA | ||
P08800 | GVIIJ[(Btr)2W,T9A,(Scc)24(Eac)] | synthetic construct | GWCGDOGAACGKLRLYCCSGFCD(Eac)YTKTCKDKSSA | ||
P08805 | GVIIJ[(Btr)2W,Y16A,(Scc)24(Eac)] | synthetic construct | GWCGDOGATCGKLRLACCSGFCD(Eac)YTKTCKDKSSA | ||
P06835 | GVIIJ[(Btr)2W] | O1 superfamily | GWCGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKSSA | ||
P04418 | ImI [P60] | synthetic construct | GCCSDORCAWRC(nh2) | ||
P10519 | In1.1 | Conus inscriptus | EGCCSNPOCRHNHOEVC(nh2) | ||
P10520 | In1.2 | Conus inscriptus | ZGCCSNPOCRHNHPEVC(nh2) | ||
P10521 | In1.3 | Conus inscriptus | GCCSHPOCNVNNPHICG(nh2) | ||
P10522 | In3.2 | Conus inscriptus | CCEWOCHHGCIPCCY(nh2) | ||
P02625 | LtIIIA | M superfamily | Conus litteratus | D(Gla)CC(Gla)OQWCDGACDCCS | |
P02857 | marmophin [d13>D] | synthetic construct | DWEYHAHPKONSFWT | ||
P03607 | Mi20.1 | D superfamily | Conus miles | DVQ(Gla)CQVVTOGSKWGRCCLNRVCGPMCCPASHCYCIY HRGKGHGCSC |
|
P03609 | Mi20.2 | D superfamily | Conus miles | DVQ(Gla)CQVVTOGSKWGRCCLNRVCGPMCCPASHCYCIY HRGRGHGCSC |
|
P03611 | Mi20.3 | D superfamily | Conus miles | DAQGCQVVTOGSKWGRCCLNRVCGPMCCPASHCYCIYHRGR GHGCSC |
|
P03613 | Mi20.4 | D superfamily | Conus miles | DVQDCQVSTOGSKWGRCCLNRVCGPMCCPASHCYCVYHRGR GHGCSC |
|
P02527 | MIVA | A superfamily | Conus magus (Magus cone) | AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS COOKRKO(nh2) |
|
P07647 | MoVIA | O1 superfamily | Conus moncuri | CKPOGSKCSOSMRDCCTTCISYTKRCRKYYN | |
P07646 | MoVIB | O1 superfamily | Conus moncuri | CKPOGSKCSOSMRDCCTTCISYTKRCRKYY | |
P07649 | MoVIB[R13Y] | synthetic construct | CKPOGSKCSOSMYDCCTTCISYTKRCRKYY | ||
P05459 | Mr062 | O1 superfamily | Conus marmoreus | CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC AT(Btr)LDL |
|
P04662 | Mr1.8 | A superfamily | Conus marmoreus | ROECCTHOACHVSNPELCS | |
P05484 | Mr10.2 | T superfamily | Conus marmoreus | ACCVYKICYOC | |
P05367 | Mr11.1 | I1 superfamily | Conus marmoreus | DKWGTCSLLGKGCRHHSDCCWDLCCTGKTCVMTVLOCLFLS LIVRWT |
|
P05487 | Mr15.1 | N superfamily | Conus marmoreus | CSSGKTCGSVEOVLCCARSDCYCRLIQTRSYWVOICVCP | |
P05489 | Mr15.2 | N superfamily | Conus marmoreus | CRSGKTCORVGODVCC(Gla)RSDCFCKLVOARPFWRYRCI CL |
|
P05416 | Mr3.11 | M superfamily | Conus marmoreus | CCRIACNLKCNOCC(nh2) | |
P02687 | Mr3.4 | M superfamily | Conus marmoreus | SKQCCHLPACRFGCTOCCW | |
P05380 | Mr6.16 | O2 superfamily | Conus marmoreus | TTAES(Btr)WEGECLGWSNGCTHOSDCCSNYCKGIYCDL | |
P05495 | Mr6.23 | H superfamily | Conus marmoreus | STDCNGVOCQFGCCVTINGNDECRELDC | |
P05514 | Mr6.24 | H superfamily | Conus marmoreus | STDCNGVOCEFGCCVTINGNDECREIGCE | |
P05503 | Mr6.26 | H superfamily | Conus marmoreus | IEEDCGYVOCEFGCCRIIDGKEKCREIDCQ | |
P01384 | MrIA | T superfamily | Conus marmoreus | NGVCCGYKLCHOC | |
P08720 | MrIA [del1,Y7Sty] | synthetic construct | GVCCG(sTy)KLCHOC | ||
P08715 | MrIA [del1-2] | synthetic construct | VCCGYKLCHOC | ||
P08716 | MrIA [del1-4] | synthetic construct | CGYKLCHOC | ||
P08717 | MrIA [del1-5] | synthetic construct | GYKLCHOC | ||
P08718 | MrIA [del1-6] | synthetic construct | YKLCHOC | ||
P07576 | MrIA [insN_(Hfe)] | synthetic construct | (HFE)NGVCCGYKLCHOC(nh2) | ||
P08714 | MrIA [insN_LR] | synthetic construct | LRNGVCCGYKLCHOC | ||
P07575 | MrIA [insN_W] | synthetic construct | WNGVCCGYKLCHOC(nh2) | ||
P07571 | MrIA [N1(Abz)] | synthetic construct | (ABZ)GVCCGYKLCHOC(nh2) | ||
P07560 | MrIA [N1(Bhk)] | synthetic construct | (BHK)GVCCGYKLCHOC(nh2) | ||
P07568 | MrIA [N1(Cit)] | synthetic construct | (Cit)GVCCGYKLCHOC(nh2) | ||
P07574 | MrIA [N1(Dmf)] | synthetic construct | (DMF)GVCCGYKLCHOC(nh2) | ||
P07563 | MrIA [N1(Nle)] | synthetic construct | (Nle)GVCCGYKLCHOC(nh2) | ||
P07565 | MrIA [N1A] | synthetic construct | AGVCCGYKLCHOC(nh2) | ||
P07570 | MrIA [N1D] | synthetic construct | DGVCCGYKLCHOC(nh2) | ||
P07567 | MrIA [N1F] | synthetic construct | FGVCCGYKLCHOC(nh2) | ||
P07564 | MrIA [N1G] | synthetic construct | GGVCCGYKLCHOC(nh2) | ||
P07566 | MrIA [N1I] | synthetic construct | IGVCCGYKLCHOC(nh2) | ||
P07561 | MrIA [N1k] | synthetic construct | kGVCCGYKLCHOC(nh2) | ||
P07572 | MrIA [N1n] | synthetic construct | nGVCCGYKLCHOC(nh2) | ||
P07569 | MrIA [N1Q] | synthetic construct | QGVCCGYKLCHOC(nh2) | ||
P07558 | MrIA [N1R] | synthetic construct | RGVCCGYKLCHOC(nh2) | ||
P07559 | MrIA [N1r] | synthetic construct | rGVCCGYKLCHOC(nh2) | ||
P07562 | MrIA [N1S] | synthetic construct | SGVCCGYKLCHOC(nh2) | ||
P07573 | MrIA [N1T] | synthetic construct | TGVCCGYKLCHOC(nh2) | ||
P07635 | MrIA [N1Z, C10c] | synthetic construct | ZGVCCGYKLcHOC(nh2) | ||
P07637 | MrIA [N1Z, C13c] | synthetic construct | ZGVCCGYKLCHOc(nh2) | ||
P07639 | MrIA [N1Z, C4(Hcy), C5(Hcy), C10(Hcy), C13(Hcy)] | synthetic construct | ZGV(Hcy)(Hcy)GYKL(Hcy)HO(Hcy)(nh2) | ||
P07636 | MrIA [N1Z, C4c, C13c] | synthetic construct | ZGVcCGYKLCHOc(nh2) | ||
P07633 | MrIA [N1Z, C4c, C5c, C10c, C13c] | synthetic construct | ZGVccGYKLcHOc(nh2) | ||
P07638 | MrIA [N1Z, C4c] | synthetic construct | ZGVcCGYKLCHOC(nh2) | ||
P07634 | MrIA [N1Z, C5c, C10c] | synthetic construct | ZGVCcGYKLcHOC(nh2) | ||
P07640 | MrIA [N1Z, Y7(Mty), H11W] | synthetic construct | ZGVCCG(Mty)KLCWOC(nh2) | ||
P07641 | MrIA [N1Z, Y7(Mty), L9(Cha), H11W] | synthetic construct | ZGVCCG(Mty)K(Cha)CWOC(nh2) | ||
P07621 | MrIA [N1Z,H11(Bta)] | synthetic construct | ZGVCCGYKLC(BTA)OC(nh2) | ||
P07616 | MrIA [N1Z,H11(Fla)] | synthetic construct | ZGVCCGYKLC(FLA)OC(nh2) | ||
P07620 | MrIA [N1Z,H11(Nal)] | synthetic construct | ZGVCCGYKLC(Nal)OC(nh2) | ||
P07617 | MrIA [N1Z,H11(Pya)] | synthetic construct | ZGVCCGYKLC(PYA)OC(nh2) | ||
P07625 | MrIA [N1Z,H11E] | synthetic construct | ZGVCCGYKLCEOC(nh2) | ||
P07615 | MrIA [N1Z,H11F] | synthetic construct | ZGVCCGYKLCFOC(nh2) | ||
P07622 | MrIA [N1Z,H11h] | synthetic construct | ZGVCCGYKLChOC(nh2) | ||
P07624 | MrIA [N1Z,H11L] | synthetic construct | ZGVCCGYKLCLOC(nh2) | ||
P07623 | MrIA [N1Z,H11P] | synthetic construct | ZGVCCGYKLCPOC(nh2) | ||
P07626 | MrIA [N1Z,H11Q] | synthetic construct | ZGVCCGYKLCQOC(nh2) | ||
P07614 | MrIA [N1Z,H11R] | synthetic construct | ZGVCCGYKLCROC(nh2) | ||
P07619 | MrIA [N1Z,H11W] | synthetic construct | ZGVCCGYKLCWOC(nh2) | ||
P07618 | MrIA [N1Z,H11Y] | synthetic construct | ZGVCCGYKLCYOC(nh2) | ||
P07603 | MrIA [N1Z,K8(Cit)] | synthetic construct | ZGVCCGY(Cit)LCHOC(nh2) | ||
P07596 | MrIA [N1Z,K8(Hly)] | synthetic construct | ZGVCCGY(HLY)LCHOC(nh2) | ||
P07602 | MrIA [N1Z,K8(Nle)] | synthetic construct | ZGVCCGY(Nle)LCHOC(nh2) | ||
P07595 | MrIA [N1Z,K8(Orn)] | synthetic construct | ZGVCCGY(Orn)LCHOC(nh2) | ||
P07601 | MrIA [N1Z,K8E] | synthetic construct | ZGVCCGYELCHOC(nh2) | ||
P07600 | MrIA [N1Z,K8I] | synthetic construct | ZGVCCGYILCHOC(nh2) | ||
P07594 | MrIA [N1Z,K8k] | synthetic construct | ZGVCCGYkLCHOC(nh2) | ||
P07599 | MrIA [N1Z,K8L] | synthetic construct | ZGVCCGYLLCHOC(nh2) | ||
P07598 | MrIA [N1Z,K8Q] | synthetic construct | ZGVCCGYQLCHOC(nh2) | ||
P07597 | MrIA [N1Z,K8R] | synthetic construct | ZGVCCGYRLCHOC(nh2) | ||
P07604 | MrIA [N1Z,K8W] | synthetic construct | ZGVCCGYWLCHOC(nh2) | ||
P07608 | MrIA [N1Z,L9(Cha)] | synthetic construct | ZGVCCGYK(Chg)CHOC(nh2) | ||
P07607 | MrIA [N1Z,L9(Hle)] | synthetic construct | ZGVCCGYK(HLE)CHOC(nh2) | ||
P07606 | MrIA [N1Z,L9(Nle)] | synthetic construct | ZGVCCGYK(Nle)CHOC(nh2) | ||
P07610 | MrIA [N1Z,L9I] | synthetic construct | ZGVCCGYKICHOC(nh2) | ||
P07611 | MrIA [N1Z,L9P] | synthetic construct | ZGVCCGYKPCHOC(nh2) | ||
P07609 | MrIA [N1Z,L9Q] | synthetic construct | ZGVCCGYKQCHOC(nh2) | ||
P07612 | MrIA [N1Z,L9R] | synthetic construct | ZGVCCGYKRCHOC(nh2) | ||
P07613 | MrIA [N1Z,L9S] | synthetic construct | ZGVCCGYKSCHOC(nh2) | ||
P07605 | MrIA [N1Z,L9V] | synthetic construct | ZGVCCGYKVCHOC(nh2) | ||
P07582 | MrIA [N1Z,Y7(Cha)] | synthetic construct | ZGVCCG(Cha)KLCHOC(nh2) | ||
P07577 | MrIA [N1Z,Y7(Dmk)] | synthetic construct | ZGVCCG(DMF)KLCHOC(nh2) | ||
P07578 | MrIA [N1Z,Y7(Dpa)] | synthetic construct | ZGVCCG(DPA)KLCHOC(nh2) | ||
P07579 | MrIA [N1Z,Y7(Hly)] | synthetic construct | ZGVCCG(HLY)KLCHOC(nh2) | ||
P07581 | MrIA [N1Z,Y7(Mty)] | synthetic construct | ZGVCCG(Mty)KLCHOC(nh2) | ||
P07593 | MrIA [N1Z,Y7(Thi)] | synthetic construct | ZGVCCG(THI)KLCHOC(nh2) | ||
P07584 | MrIA [N1Z,Y7E] | synthetic construct | ZGVCCGEKLCHOC(nh2) | ||
P07580 | MrIA [N1Z,Y7F] | synthetic construct | ZGVCCGFKLCHOC(nh2) | ||
P07585 | MrIA [N1Z,Y7I] | synthetic construct | ZGVCCGIKLCHOC(nh2) | ||
P07586 | MrIA [N1Z,Y7K] | synthetic construct | ZGVCCGKKLCHOC(nh2) | ||
P07587 | MrIA [N1Z,Y7L] | synthetic construct | ZGVCCGLKLCHOC(nh2) | ||
P07588 | MrIA [N1Z,Y7P] | synthetic construct | ZGVCCGPKLCHOC(nh2) | ||
P07589 | MrIA [N1Z,Y7Q] | synthetic construct | ZGVCCGQKLCHOC(nh2) | ||
P07590 | MrIA [N1Z,Y7R] | synthetic construct | ZGVCCGRKLCHOC(nh2) | ||
P07591 | MrIA [N1Z,Y7S] | synthetic construct | ZGVCCGSKLCHOC(nh2) | ||
P07583 | MrIA [N1Z,Y7W] | synthetic construct | ZGVCCGWKLCHOC(nh2) | ||
P07592 | MrIA [N1Z,Y7y] | synthetic construct | ZGVCCGyKLCHOC(nh2) | ||
P06932 | MrIA [N1Z] | synthetic construct | ZGVCCGYKLCHOC(nh2) | ||
P04492 | MrIA amidated | synthetic construct | NGVCCGYKLCHOC(nh2) | ||
P01737 | MrIB | T superfamily | Conus marmoreus | VGVCCGYKLCHOC | |
P02849 | MrIB amidated | synthetic construct | VGVCCGYKLCHOC(nh2) | ||
P01422 | MrIIIA | M superfamily | Conus marmoreus | GCCGSFACRFGCVOCCV | |
P01465 | MrIIIB | M superfamily | Conus marmoreus | SKQCCHLAACRFGCTOCCW | |
P01486 | MrIIIC | M superfamily | Conus marmoreus | CCAPSACRLGCROCCR | |
P02696 | MrIIID | M superfamily | Conus marmoreus | CCRLSCGLGCHOCC(nh2) | |
P02698 | MrIIIG | M superfamily | Conus marmoreus | DCCOLPACPFGCNOCC(nh2) | |
P03597 | Ms20.1 | D superfamily | Conus mustelinus | DVR(Gla)CNINTOGSSWGKCCLTRMCGPMCCARSGCTCVY HWRRGHGCSCPG |
|
P03599 | Ms20.2 | D superfamily | Conus mustelinus | DVR(Gla)CNINTOGSSWGKCCLTRMCGTMCCARSGCTCVY HWRRGHGCSCPG |
|
P03601 | Ms20.3 | D superfamily | Conus mustelinus | DVR(Gla)CQVNTOGSSWGKCCMTRMCGTMCCARSGCTCVY HWRRGHGCSCPG |
|
P03603 | Ms20.4 | D superfamily | Conus mustelinus | DNE(Gla)ECQINOPGSSWGKCCMTRMCGTMCCARSGCTCV YHWRRGHGCSCPG |
|
P03605 | Ms20.5 | D superfamily | Conus mustelinus | DNE(Gla)ECQINOPGSSWGKCCLTRMCGPMCCARSGCTCV YHWRRGHGCSCPG |
|
P01624 | MVIA | O1 superfamily | Conus magus (Magus cone) | DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2) | |
P01623 | MVIB | O1 superfamily | Conus magus (Magus cone) | EACYNAGSFCGIHOGLCCSEFCILWCITFVDS(nh2) | |
P01622 | MVIC | O1 superfamily | Conus magus (Magus cone) | DECYPPGTFCGIKOGLCCSAICLSFVCISFDF | |
P01621 | MVID | O1 superfamily | Conus magus (Magus cone) | EACYNAGTFCGIKOGLCCSAICLSFVCISFDF | |
P01519 | NgVIA | Conus nigropunctatus | SKCFSOGTFCGIKOGLCCSVRCFSLFCISFE | ||
P01397 | OIVA | A superfamily | Conus obscurus | CCGVONAACHOCVCKNTC(nh2) | |
P04446 | OIVA [H10P] | synthetic construct | CCGVONAACPOCVCKNTC(nh2) | ||
P04447 | OIVA [K15N] | synthetic construct | CCGVONAACHOCVCNNTC(nh2) | ||
P01688 | OIVB | A superfamily | Conus obscurus | CCGVONAACPOCVCNKTCG(nh2) | |
P04061 | P21a | Conus purpurascens | FELLPSQDRSCCIQKTLECLENYOGQASQRAHYCQQDATTN CODTYYFGCCPGYATCMSINAGNNVRSAFDKCINRLCFDPG H(nh2) |
||
P06789 | PeIA[P13O] | synthetic construct | GCCSHPACSVNHOELC(nh2) | ||
P06784 | PeIA[P6O] | synthetic construct | GCCSHOACSVNHPELC(nh2) | ||
P01689 | PeIVA | A superfamily | Conus pergrandis | CCGVONAACHOCVCTGKC | |
P01687 | PeIVB | A superfamily | Conus pergrandis | CCGIONAACHOCVCTGKC | |
P00038 | PIB | A superfamily | Conus purpurascens | ZSOGCCWNPACVKNRC(nh2) | |
P08506 | PIC | Conus purpurascens | SGCCKHOACGKNRC | ||
P02228 | PIIIA | M superfamily | Conus purpurascens | ZRLCCGFOKSCRSRQCKOHRCC(nh2) | |
P04296 | PIIIA [G6K] | synthetic construct | ZRLCCKFOKSCRSRQCKOHRCC(nh2) | ||
P04300 | PIIIA [K17A] | synthetic construct | ZRLCCAFOKSCRSRQCAOHRCC(nh2) | ||
P04301 | PIIIA [K17Q] | synthetic construct | ZRLCCAFOKSCRSRQCQOHRCC(nh2) | ||
P04294 | PIIIA [K17R] | synthetic construct | ZRLCCGFOKSCRSRQCROHRCC(nh2) | ||
P04297 | PIIIA [R12A] | synthetic construct | ZRLCCAFOKSCASRQCKOHRCC(nh2) | ||
P04293 | PIIIA [R12K] | synthetic construct | ZRLCCGFOKSCKSRQCKOHRCC(nh2) | ||
P04298 | PIIIA [R12Q] | synthetic construct | ZRLCCAFOKSCQSRQCKOHRCC(nh2) | ||
P04290 | PIIIA [R14A] | synthetic construct | ZRLCCGFOKSCRSAQCKOHRCC(nh2) | ||
P04292 | PIIIA [R14K] | synthetic construct | ZRLCCGFOKSCRSKQCKOHRCC(nh2) | ||
P04291 | PIIIA [R14Q] | synthetic construct | ZRLCCGFOKSCRSQQCKOHRCC(nh2) | ||
P04302 | PIIIA [R20A] | synthetic construct | ZRLCCAFOKSCRSRQCKOHACC(nh2) | ||
P04295 | PIIIA [R2A] | synthetic construct | ZALCCGFOKSCRSRQCKOHRCC(nh2) | ||
P04299 | PIIIA [S13D] | synthetic construct | ZRLCCAFOKSCRDRQCKOHRCC(nh2) | ||
P01611 | PIIIE | M superfamily | Conus purpurascens | HOOCCLYGKCRRYOGCSSASCCQR(nh2) | |
P04448 | PIIIE [K9S] | synthetic construct | HOOCCLYGKCRRYOGCSSASCCQR(nh2) | ||
P04449 | PIIIE [R12O,Y13F] | synthetic construct | HOOCCLYGKCROFOGCSSASCCQR(nh2) | ||
P04450 | PIIIE [S17Y,S18N,S20L] | synthetic construct | HOOCCLYGKCRRYOGCSSASCCQR(nh2) | ||
P01594 | PIIIF | M superfamily | Conus purpurascens | GOOCCLYGSCROFOGCYNALCCRK(nh2) | |
P04452 | PIIIF [O12R,F13Y] | synthetic construct | GOOCCLYGSCRRYOGCYNALCCRK(nh2) | ||
P04451 | PIIIF [S9K] | synthetic construct | GOOCCLYGSCROFOGCYNALCCRK(nh2) | ||
P04453 | PIIIF [Y17S,N18S,L20S] | synthetic construct | GOOCCLYGSCROFOGCSSASCCRK(nh2) | ||
P01449 | PIVA | A superfamily | Conus purpurascens | GCCGSYONAACHOCSCKDROSYCGQ(nh2) | |
P01612 | PIVA [Hyp7P,Hyp13P] | synthetic construct | GCCGSYPNAACHPCSCKDROSYCGQ(nh2) | ||
P06978 | PiVIIA | Conus princeps (Prince cone) | CDAOTHYCTNYW(Gla)CCSGYC(Gla)HSHCW | ||
P08998 | PiXXA | D superfamily | Conus princeps (Prince cone) | AVKKTCIRSTOGSNWGRCCLTKMCHTLCCARSDCTCVYRSG KGHGCSCTS |
|
P04431 | PnIA [P6O] | synthetic construct | GCCSLOPCAANNPD(sTy)C(nh2) | ||
P01636 | PnVIIA | O2 superfamily | Conus pennaceus | DCTSWFGRCTVNS(Gla)CCSNSCDQTYC(Gla)LYAFOS | |
P04211 | Pr3b | Conus parius | ERVCCGYOMSCKSRACKOSYCC(nh2) | ||
P04213 | Pr6b | Conus parius | FGSFIOCAHKGEOCTICCROLRCHEEKTOTCV | ||
P04215 | Pr6d | Conus parius | YGNFOTCSETGEDCSAMHCCRSMTCRNNICAD | ||
P02859 | PrXA | C superfamily | Conus parius | TYGIYDAKPOFSCAGLRGGCVLPONLROKFKE(nh2) | |
P04205 | Pu3.4 | M superfamily | Conus pulicarius | CCDWPCNAGCVOCCF | |
P02595 | PVIA | O1 superfamily | Conus purpurascens | EACYAOGTFCGIKOGLCCSEFCLPGVCFG(nh2) | |
P01356 | PVIIA | O1 superfamily | Conus purpurascens | CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | |
P04364 | PVIIA [D13A] | synthetic construct | CRIONQKCFQHLADCCSRKCNRFNKCV(nh2) | ||
P04369 | PVIIA [F23A] | synthetic construct | CRIONQKCFQHLDDCCSRKCNRANKCV(nh2) | ||
P04359 | PVIIA [F9A] | synthetic construct | CRIONQKCAQHLDDCCSRKCNRFNKCV(nh2) | ||
P04360 | PVIIA [F9M] | synthetic construct | CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04361 | PVIIA [F9Y] | synthetic construct | CRIONQKCYQHLDDCCSRKCNRFNKCV(nh2) | ||
P04363 | PVIIA [H11A] | synthetic construct | CRIONQKCFQALDDCCSRKCNRFNKCV(nh2) | ||
P04355 | PVIIA [I3A] | synthetic construct | CRAONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P07500 | PVIIA [insN_GGG,insC_LPET] cyclic | synthetic construct | GGGORIPNQKCFQHLDDCCSRKCNRFNKCVLPET | ||
P04367 | PVIIA [K19A] | synthetic construct | CRIONQKCFQHLDDCCSRACNRFNKCV(nh2) | ||
P04371 | PVIIA [K25A] | synthetic construct | CRIONQKCFQHLDDCCSRKCNRFNACV(nh2) | ||
P04357 | PVIIA [K7A] | synthetic construct | CRIONQACFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04358 | PVIIA [K7R] | synthetic construct | CRIONQRCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04370 | PVIIA [N24A] | synthetic construct | CRIONQKCFQHLDDCCSRKCNRFAKCV(nh2) | ||
P04362 | PVIIA [Q10A] | synthetic construct | CRIONQKCFAHLDDCCSRKCNRFNKCV(nh2) | ||
P04356 | PVIIA [Q6A] | synthetic construct | CRIONAKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04366 | PVIIA [R18A] | synthetic construct | CRIONQKCFQHLDDCCSAKCNRFNKCV(nh2) | ||
P04368 | PVIIA [R22A] | synthetic construct | CRIONQKCFQHLDDCCSRKCNAFNKCV(nh2) | ||
P04352 | PVIIA [R2A] | synthetic construct | CAIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04354 | PVIIA [R2K] | synthetic construct | CKIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04353 | PVIIA [R2Q] | synthetic construct | CQIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04365 | PVIIA [S17A] | synthetic construct | CRIONQKCFQHLDDCCARKCNRFNKCV(nh2) | ||
P01514 | QcIIIA | M superfamily | Conus quercinus | CCSQDCLVCIOCCPN(nh2) | |
P01513 | QcIIIB | M superfamily | Conus quercinus | CCSRHCWVCIOCCPN(nh2) | |
P01512 | QcVIA | O1 superfamily | Conus quercinus | DQSCOWCGFTCCLPNYCQGLTCTVI | |
P00841 | R11.17 | I1 superfamily | Conus radiatus | GOSFCKANGKOCSYHADCCNCCLSGICAOSTNWILPGCSTS SFlKI |
|
P01493 | Reg12e | M superfamily | Conus regius | KCCMRPICTCOCCIGP(nh2) | |
P01488 | Reg12k | M superfamily | Conus regius | KCCMRPICMCOCCIGAG | |
P00028 | Reg1b/Reg1c | A superfamily | Conus regius | GCCSDORCKHQC(nh2) | |
P00031 | Reg1f | A superfamily | Conus regius | DYCCRROOCTLIC(nh2) | |
P08570 | reg3a | M superfamily | Conus regius | GCCOOQWCGODCTSOCC | |
P08572 | reg3c | Conus regius | CCAFOQWCGAGCIVOCC | ||
P08573 | reg3d | Conus regius | LCCOOQOCGODCASOCC | ||
P08533 | reg3e | Conus regius | KCCMRPICTCOCCIGP | ||
P08538 | reg3h | Conus regius | GCCSOWNCIQLRACOCCON(nh2) | ||
P08561 | reg3i | Conus regius | CCAIRLCNVYLCGSCCO | ||
P08540 | reg3j | Conus regius | GCCSOWNCIQLRACGCC | ||
P08534 | reg3k | M superfamily | Conus regius | KCCMRPICMCOCCIGP(nh2) | |
P00030 | RgIA [P6O,del13] | A superfamily | Conus regius | GCCSDORCRYRC(nh2) | |
P03906 | RIIIJ | Conus radiatus | LOOCCTOOKKHCOAOACKYKOCCKS | ||
P04237 | RIIIJΔ10-11 | synthetic construct | LOOCCTOOKRLCOAOACKYKOCCKS | ||
P04234 | RIIIJΔ6-11 | synthetic construct | LOOCCSLNLRLCOAOACKYKOCCKS | ||
P04235 | RIIIJΔ6-8 | synthetic construct | LOOCCSLNKKHCOAOACKYKOCCKS | ||
P04236 | RIIIJΔ9-11 | synthetic construct | LOOCCTOOLRLCOAOACKYKOCCKS | ||
P02591 | RIIIK | M superfamily | Conus radiatus | LOSCCSLNLRLCOVOACKRNOCCT(nh2) | |
P04337 | RIIIK [K18A] | synthetic construct | LOSCCSLNLRLCOVOACARNOCCT(nh2) | ||
P04339 | RIIIK [K18R, R19K] | synthetic construct | LOSCCSLNLRLCOVOACRKNOCCT(nh2) | ||
P04333 | RIIIK [L11A] | synthetic construct | LOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04325 | RIIIK [L1A] | synthetic construct | AOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04344 | RIIIK [L1E] | synthetic construct | EOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04350 | RIIIK [L1F] | synthetic construct | FOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04345 | RIIIK [L1H] | synthetic construct | HOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04346 | RIIIK [L1I] | synthetic construct | IOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04348 | RIIIK [L1K] | synthetic construct | KOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04347 | RIIIK [L1M] | synthetic construct | MOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04349 | RIIIK [L1R] | synthetic construct | ROSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04351 | RIIIK [L1Y] | synthetic construct | YOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04329 | RIIIK [L7A] | synthetic construct | LOSCCSANLRLCOVOACKRNOCCT(nh2) | ||
P04331 | RIIIK [L9A] | synthetic construct | LOSCCSLNARLCOVOACKRNOCCT(nh2) | ||
P04340 | RIIIK [N20A] | synthetic construct | LOSCCSLNLRLCOVOACKRAOCCT(nh2) | ||
P04330 | RIIIK [N8A] | synthetic construct | LOSCCSLALRLCOVOACKRNOCCT(nh2) | ||
P04334 | RIIIK [O13A] | synthetic construct | LOSCCSLNLRLCAVOACKRNOCCT(nh2) | ||
P04336 | RIIIK [O15A] | synthetic construct | LOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04341 | RIIIK [O21A] | synthetic construct | LOSCCSLNLRLCOVOACKRNACCT(nh2) | ||
P04326 | RIIIK [O2A] | synthetic construct | LASCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04332 | RIIIK [R10A] | synthetic construct | LOSCCSLNLALCOVOACKRNOCCT(nh2) | ||
P04338 | RIIIK [R19A] | synthetic construct | LOSCCSLNLRLCOVOACKANOCCT(nh2) | ||
P04327 | RIIIK [S3A] | synthetic construct | LOACCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04328 | RIIIK [S6A] | synthetic construct | LOSCCALNLRLCOVOACKRNOCCT(nh2) | ||
P04342 | RIIIK [T24A] | synthetic construct | LOSCCSLNLRLCOVOACKRNOCCA(nh2) | ||
P04335 | RIIIK [V14A] | synthetic construct | LOSCCSLNLRLCOAOACKRNOCCT(nh2) | ||
P04238 | RIIIKΔ9 | synthetic construct | LOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P03615 | Rt20.1 | D superfamily | Conus rattus | DAR(Gla)CQVNTOGSRWGKCCLNRMCGPMCCPESHCYCVY HRRRGHGCSC |
|
P03617 | Rt20.2 | D superfamily | Conus rattus | DAR(Gla)CQVNTOGSRWGKCCLNRMCGPMCCPESHCYCIY HRRRGHGCSC |
|
P01728 | RVIA | Conus radiatus | CKPOGSOCRVSSYNCCSSCKSYNKKCG | ||
P00840 | RXIA | I1 superfamily | Conus radiatus | GOSFCKADEKOCEYHADCCNCCLSGICAOSTNWILPGCSTS SFfKI |
|
P02784 | RXIA [BTr33>W] | synthetic construct | GOSFCKADEKOCEYHADCCNCCLSGICAOSTNWILPGCSTS SFfKI |
||
P00842 | RXIB | I1 superfamily | Conus radiatus | GOSFCKANGKOCSYHADCCNCCLSGICKOSTNVILPGCSTS SFfRI |
|
P02592 | RXIC | I1 superfamily | Conus radiatus | GOSFCKADEKOCKYHADCCNCCLGGICKOSTSWIGCSTNVF lT |
|
P00843 | RXID | I1 superfamily | Conus radiatus | GCKKDRKOCSYHADCCNCCLSGICAOSTNWILPGCSTSTFT | |
P02524 | SIVA | A superfamily | Conus striatus (Striated cone) | ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2) | |
P02525 | SIVB | A superfamily | Conus striatus (Striated cone) | ZKELVP(gSr)VITTCCGYDOGTMCOOCRCTNSCOTKOKKO (nh2) |
|
P10735 | SIVC | Conus striatus (Striated cone) | AOALVV(gTr)A(gTr)TNCCGYTGOACHOCLCTQTC(nh2) | ||
P02980 | Sm1.1 | A superfamily | Conus stercusmuscarum | GRCCHPACGONYSC(nh2) | |
P02530 | SmIVA | A superfamily | Conus stercusmuscarum | ZTWLVP(gSr)(gTr)ITTCCGYDOGTMCOTCMCDNTCKOK OKKS(nh2) |
|
P02529 | SmIVB | A superfamily | Conus stercusmuscarum | ZPWLVP(gSr)(gTr)ITTCCGYDOGSMCOOCMCNNTCKOK OKKS(nh2) |
|
P01620 | SmVIA | O1 superfamily | Conus stercusmuscarum | DGCSSGGTFCGIROGLCCSEFCFLWCITFID | |
P03902 | Sr1.1 | synthetic construct | RTCCSROTCRMEYPELCG(nh2) | ||
P03752 | SrIA | A superfamily | Conus spurius | RTCCSROTCRM(Gla)YP(Gla)LCG(nh2) | |
P03901 | SrIB | A superfamily | Conus spurius | RTCCSROTCRMEYP(Gla)LCG(nh2) | |
P04445 | SrIB [Gla15E] | synthetic construct | RTCCSROTCRMEYPELCG(nh2) | ||
P01794 | SVIA | O1 superfamily | Conus striatus (Striated cone) | CRSSGSOCGVTSICCGRCYRGKCT(nh2) | |
P02710 | SVIE | O1 superfamily | Conus striatus (Striated cone) | DGCSSGGTFCGIHOGLCCSEFCFLWCITFID | |
P01616 | TIIIA | M superfamily | Conus tulipa (tulip cone) | RHGCCKGOKGCSSRECROQHCC(nh2) | |
P05821 | TIIIA[E15A,insC_A] | synthetic construct | RHGCCKGOKGCSSRACROQHCCA(nh2) | ||
P05822 | TIIIA[E15A,insC_AA] | synthetic construct | RHGCCKGOKGCSSRACROQHCCAA(nh2) | ||
P05826 | TIIIA[E15A,insC_AD] | synthetic construct | RHGCCKGOKGCSSRACROQHCCAD(nh2) | ||
P05825 | TIIIA[E15A,insC_AK] | synthetic construct | RHGCCKGOKGCSSRACROQHCCAK(nh2) | ||
P05824 | TIIIA[E15A,insC_D] | synthetic construct | RHGCCKGOKGCSSRACROQHCCD(nh2) | ||
P05823 | TIIIA[E15A,insC_K] | synthetic construct | RHGCCKGOKGCSSRACROQHCCK(nh2) | ||
P05820 | TIIIA[E15A] | synthetic construct | RHGCCKGOKGCSSRACROQHCC(nh2) | ||
P01727 | TVIA | Conus tulipa (tulip cone) | CLSOGSSCSOTSYNCCRSCNOYSRKC | ||
P01405 | TVIIA | O1 superfamily | Conus tulipa (tulip cone) | SCSGRDSRCOOVCCMGLMCSRGKCVSIYGE | |
P02883 | Tx1.2 | A superfamily | Conus textile (Cloth-of-gold cone) | ROQCCSHOACNVDHPEIC | |
P03755 | Tx10b | Conus textile (Cloth-of-gold cone) | DPCCGYRMCVOC(nh2) | ||
P03754 | Tx10c | Conus textile (Cloth-of-gold cone) | ZTCCGYRMCVOC(nh2) | ||
P03749 | Tx3e | Conus textile (Cloth-of-gold cone) | SCCNAGFCRFGCTOCCY | ||
P05831 | Tx3i | Conus textile (Cloth-of-gold cone) | CCGOTACLAGCKPCC(nh2) | ||
P05834 | Tx3j | Conus textile (Cloth-of-gold cone) | CCDDSECSTSCWOCCY | ||
P05835 | Tx6.5 | Conus textile (Cloth-of-gold cone) | NCPYCVVYCCPOAYCQASGCRPP | ||
P05832 | TxIC | T superfamily | Conus textile (Cloth-of-gold cone) | DKQTCCGYRMCVOC(nh2) | |
P02562 | TxIIIC | M superfamily | Conus textile (Cloth-of-gold cone) | CCRTCFGCTOCC(nh2) | |
P03212 | TxMEKL-P2 | O2 superfamily | Conus textile (Cloth-of-gold cone) | DCRGYDAOCSSGAPCCD(Btr)(Btr)TCSARTNRCF | |
P03156 | TxMMSK-03 | M superfamily | Conus textile (Cloth-of-gold cone) | CCNAGFCRFGCTOCCY | |
P02556 | TxO4 | O1 superfamily | Conus textile (Cloth-of-gold cone) | YDCEPPGNFCGMIKIGPOCCSG(Btr)CFFACA | |
P01543 | TxVA | T superfamily | Conus textile (Cloth-of-gold cone) | (Gla)CC(Gla)DG(Btr)CC(gTr)AAO | |
P04466 | Vc1.1 [P6O] | synthetic construct | GCCSDORCNYDHPEIC(nh2) | ||
P09005 | Vc1.1[P6(Hyp)] | synthetic construct | GCCSDORCNYDHPEIC(nh2) | ||
P02539 | VcIA | A superfamily | Conus victoriae | GCCSDORCNYDHP(Gla)IC(nh2) | |
P02540 | VcVA | T superfamily | Conus victoriae | CCPGKOCCRI(nh2) | |
P02649 | Vi6.1 | O1 superfamily | Conus virgo | DCGGQGEGCYTQOCCOGLRCRGGGTGGGVCQL | |
P01686 | VxXXA | D superfamily | Conus vexillum | DVQDCQVSTOGSKWGRCCLNRVCGPMCCPASHCYCVYHRGR GHGCSC |
ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.
The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).
Contacts:
David Craik
Quentin Kaas
Last updated: Monday 2 October 2023