ID | Name | Gene superfamily | Organism | Sequence | |
---|---|---|---|---|---|
P07473 | Am6.1 | O2 superfamily | Conus amadis | CDG(Btr)STYCHDDS(Gla)CST(Gla)ANSYCTLIKGV | |
P03551 | Bromocontryphan-S | Conus striatus (Striated cone) | GCO(Btr)EPWC(nh2) | ||
P03552 | Bromoheptapeptide Im | Conus imperialis | ZCGQA(Btr)C(nh2) | ||
P01811 | Bromosleeper peptide | O3 superfamily | Conus radiatus | (Btr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW QCV(Gla)ACPV |
|
P01372 | Contryphan-R | O2 superfamily | Conus radiatus | GCOwEP(Btr)C(nh2) | |
P02550 | De13a | Conus delessertii | DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG CTH(nh2) |
||
P01511 | Gla(1)-TxVI | O2 superfamily | Conus textile (Cloth-of-gold cone) | GM(Btr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla) GSCTM(Btr) |
|
P02582 | GVIIIA | S superfamily | Conus geographus (Geography cone) | GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG CACS(nh2) |
|
P06822 | GVIIJ | O1 superfamily | Conus geographus (Geography cone) | G(Btr)CGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKS SA |
|
P01617 | Mo1274 | T superfamily | Conus monile | GN(Btr)CCSARVCC | |
P05511 | Mr038 | M superfamily | Conus marmoreus | N(Gla)FLTHTFS(Btr)HPTWCPWC(nh2) | |
P05459 | Mr062 | O1 superfamily | Conus marmoreus | CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC AT(Btr)LDL |
|
P05455 | Mr14.7 | O1 superfamily | Conus marmoreus | CLDGGEICGICFQAAAVGGALFSSAHETTVMSSTPLCAT(Btr) LDL |
|
P05380 | Mr6.16 | O2 superfamily | Conus marmoreus | TTAES(Btr)WEGECLGWSNGCTHOSDCCSNYCKGIYCDL | |
P05376 | Mr6.29 | O2 superfamily | Conus marmoreus | ZC(Gla)DV(Btr)MPCTSSHW(Gla)CCSLDCEMYCTQI | |
P02589 | RVIIA | O1 superfamily | Conus radiatus | (Btr)FGH(Gla)(Gla)CTY(Btr)LGPC(Gla)VDDTCC SASC(Gla)SKFCGL(Btr) |
|
P01478 | RXIE | I1 superfamily | Conus radiatus | ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC (Btr)VDP(nh2) |
|
P02711 | TeA31 | T superfamily | Conus textile (Cloth-of-gold cone) | ICCYPNV(Btr)CCD | |
P03212 | TxMEKL-P2 | O2 superfamily | Conus textile (Cloth-of-gold cone) | DCRGYDAOCSSGAPCCD(Btr)(Btr)TCSARTNRCF | |
P02556 | TxO4 | O1 superfamily | Conus textile (Cloth-of-gold cone) | YDCEPPGNFCGMIKIGPOCCSG(Btr)CFFACA | |
P01543 | TxVA | T superfamily | Conus textile (Cloth-of-gold cone) | (Gla)CC(Gla)DG(Btr)CC(gTr)AAO | |
P02542 | VcVC | T superfamily | Conus victoriae | ICCYPN(Gla)(Btr)CCD |
ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.
The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).
Contacts:
David Craik
Quentin Kaas
Last updated: Wednesday 22 March 2023