ID | Name | Gene superfamily | Organism | Sequence | |
---|---|---|---|---|---|
P07473 | Am6.1 | O2 superfamily | Conus amadis | CDG(Btr)STYCHDDS(Gla)CST(Gla)ANSYCTLIKGV | |
P02550 | De13a | Conus delessertii | DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG CTH(nh2) |
||
P06822 | GVIIJ | O1 superfamily | Conus geographus (Geography cone) | G(Btr)CGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKS SA |
|
P02582 | GVIIIA | S superfamily | Conus geographus (Geography cone) | GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG CACS(nh2) |
|
P03552 | Bromoheptapeptide Im | Conus imperialis | ZCGQA(Btr)C(nh2) | ||
P05511 | Mr038 | M superfamily | Conus marmoreus | N(Gla)FLTHTFS(Btr)HPTWCPWC(nh2) | |
P05459 | Mr062 | O1 superfamily | Conus marmoreus | CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC AT(Btr)LDL |
|
P05455 | Mr14.7 | O1 superfamily | Conus marmoreus | CLDGGEICGICFQAAAVGGALFSSAHETTVMSSTPLCAT(Btr) LDL |
|
P05380 | Mr6.16 | O2 superfamily | Conus marmoreus | TTAES(Btr)WEGECLGWSNGCTHOSDCCSNYCKGIYCDL | |
P05376 | Mr6.29 | O2 superfamily | Conus marmoreus | ZC(Gla)DV(Btr)MPCTSSHW(Gla)CCSLDCEMYCTQI | |
P01617 | Mo1274 | T superfamily | Conus monile | GN(Btr)CCSARVCC | |
P01478 | RXIE | I1 superfamily | Conus radiatus | ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC (Btr)VDP(nh2) |
|
P01811 | Bromosleeper peptide | O3 superfamily | Conus radiatus | (Btr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW QCV(Gla)ACPV |
|
P02589 | RVIIA | O1 superfamily | Conus radiatus | (Btr)FGH(Gla)(Gla)CTY(Btr)LGPC(Gla)VDDTCC SASC(Gla)SKFCGL(Btr) |
|
P01372 | Contryphan-R | O2 superfamily | Conus radiatus | GCOwEP(Btr)C(nh2) | |
P03551 | Bromocontryphan-S | Conus striatus (Striated cone) | GCO(Btr)EPWC(nh2) | ||
P02556 | TxO4 | O1 superfamily | Conus textile (Cloth-of-gold cone) | YDCEPPGNFCGMIKIGPOCCSG(Btr)CFFACA | |
P02711 | TeA31 | T superfamily | Conus textile (Cloth-of-gold cone) | ICCYPNV(Btr)CCD | |
P03212 | TxMEKL-P2 | O2 superfamily | Conus textile (Cloth-of-gold cone) | DCRGYDAOCSSGAPCCD(Btr)(Btr)TCSARTNRCF | |
P01543 | TxVA | T superfamily | Conus textile (Cloth-of-gold cone) | (Gla)CC(Gla)DG(Btr)CC(gTr)AAO | |
P01511 | Gla(1)-TxVI | O2 superfamily | Conus textile (Cloth-of-gold cone) | GM(Btr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla) GSCTM(Btr) |
|
P02542 | VcVC | T superfamily | Conus victoriae | ICCYPN(Gla)(Btr)CCD |
ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.
The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).
Contacts:
David Craik
Quentin Kaas
Last updated: Thursday 30 November 2023