Protein List
Your search: Protein Type in [Wild type] and Sequence evidence in [protein level] and PTM in [Bromotryptophan]
| ID | Name | Gene superfamily | Organism | Sequence | |
|---|---|---|---|---|---|
| P01811 | Bromosleeper peptide | O3 superfamily | Conus radiatus | (Btr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW QCV(Gla)ACPV |
|
| P02589 | RVIIA | O1 superfamily | Conus radiatus | (Btr)FGH(Gla)(Gla)CTY(Btr)LGPC(Gla)VDDTCC SASC(Gla)SKFCGL(Btr) |
|
| P01543 | TxVA | T superfamily | Conus textile (Cloth-of-gold cone) | (Gla)CC(Gla)DG(Btr)CC(gTr)AAO | |
| P07473 | Am6.1 | O2 superfamily | Conus amadis | CDG(Btr)STYCHDDS(Gla)CST(Gla)ANSYCTLIKGV | |
| P05459 | Mr062 | O1 superfamily | Conus marmoreus | CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC AT(Btr)LDL |
|
| P05455 | Mr14.7 | O1 superfamily | Conus marmoreus | CLDGGEICGICFQAAAVGGALFSSAHETTVMSSTPLCAT(Btr) LDL |
|
| P02550 | De13a | Conus delessertii | DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG CTH(nh2) |
||
| P03212 | TxMEKL-P2 | O2 superfamily | Conus textile (Cloth-of-gold cone) | DCRGYDAOCSSGAPCCD(Btr)(Btr)TCSARTNRCF | |
| P01478 | RXIE | I1 superfamily | Conus radiatus | ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC (Btr)VDP(nh2) |
|
| P06822 | GVIIJ | O1 superfamily | Conus geographus (Geography cone) | G(Btr)CGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKS SA |
|
| P03551 | Bromocontryphan-S | Conus striatus (Striated cone) | GCO(Btr)EPWC(nh2) | ||
| P01372 | Contryphan-R | O2 superfamily | Conus radiatus | GCOwEP(Btr)C(nh2) | |
| P02582 | GVIIIA | S superfamily | Conus geographus (Geography cone) | GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG CACS(nh2) |
|
| P01511 | Gla(1)-TxVI | O2 superfamily | Conus textile (Cloth-of-gold cone) | GM(Btr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla) GSCTM(Btr) |
|
| P01617 | Mo1274 | T superfamily | Conus monile | GN(Btr)CCSARVCC | |
| P02542 | VcVC | T superfamily | Conus victoriae | ICCYPN(Gla)(Btr)CCD | |
| P02711 | TeA31 | T superfamily | Conus textile (Cloth-of-gold cone) | ICCYPNV(Btr)CCD | |
| P05511 | Mr038 | M superfamily | Conus marmoreus | N(Gla)FLTHTFS(Btr)HPTWCPWC(nh2) | |
| P05380 | Mr6.16 | O2 superfamily | Conus marmoreus | TTAES(Btr)WEGECLGWSNGCTHOSDCCSNYCKGIYCDL | |
| P02556 | TxO4 | O1 superfamily | Conus textile (Cloth-of-gold cone) | YDCEPPGNFCGMIKIGPOCCSG(Btr)CFFACA | |
| P05376 | Mr6.29 | O2 superfamily | Conus marmoreus | ZC(Gla)DV(Btr)MPCTSSHW(Gla)CCSLDCEMYCTQI | |
| P03552 | Bromoheptapeptide Im | Conus imperialis | ZCGQA(Btr)C(nh2) |
Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6
ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.
The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).
Contacts:
David Craik
Quentin Kaas
Last updated: Thursday 30 November 2023