Protein List
Your search: Protein Type in [Wild type] and Sequence evidence in [protein level] and PTM in [C-term amidation]
| ID | Name | Gene superfamily | Organism | Sequence | |
|---|---|---|---|---|---|
| P08385 | Am1.3 | A superfamily | Conus amadis | GCCSVPPCIANHPELC(nh2) | |
| P01630 | Am2766 | O1 superfamily | Conus amadis | CKQAGESCDIFSQNCCVGTCAFICIE(nh2) | |
| P08380 | Am3.1 | M superfamily | Conus amadis | GCCPALACAMGCRPCC(nh2) | |
| P08387 | Am3.3 | M superfamily | Conus amadis | GCCMPLSCMLLCEPCC(nh2) | |
| P08393 | Am3.4 | M superfamily | Conus amadis | CCKYGWTCWLGCSPCC(nh2) | |
| P02501 | AnIA | Conus anemone | CCSHPACAANNQD(sTy)C(nh2) | ||
| P00015 | AnIB | Conus anemone | GGCCSHPACAANNQD(sTy)C(nh2) | ||
| P00017 | AnIC | Conus anemone | GGCCSHPACFASNPD(sTy)C(nh2) | ||
| P05524 | As25a | Conus austini | CKCOSCNFNDVTENCKCCIFRQO(nh2) | ||
| P08781 | Asi14.1 | Conus asiaticus | SCGYPCSHCGIPGCYPG(nh2) | ||
| P08782 | Asi3.1 | Conus asiaticus | CCQWPCSHGCIPCCY(nh2) | ||
| P00404 | AuIA | A superfamily | Conus aulicus | GCCSYPPCFATNSDYC(nh2) | |
| P00095 | AuIB | A superfamily | Conus aulicus | GCCSYPPCFATNPDC(nh2) | |
| P00407 | AuIC | A superfamily | Conus aulicus | GCCSYPPCFATNSGYC(nh2) | |
| P10037 | Ba5.1 | T superfamily | Conus bayani | SCCGSSNTGSCC(nh2) | |
| P02635 | BnIA | A superfamily | Conus bandanus | GCCSHPACSVNNPDIC(nh2) | |
| P03551 | Bromocontryphan-S | Conus striatus (Striated cone) | GCO(Btr)EPWC(nh2) | ||
| P03552 | Bromoheptapeptide Im | Conus imperialis | ZCGQA(Btr)C(nh2) | ||
| P02526 | BtX | I2 superfamily | Conus betulinus | CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR HP(nh2) |
|
| P09973 | C1.3 | A superfamily | Conus catus | GCCSNPVCHLEHSNLC(nh2) | |
| P09974 | C6.2 | O1 superfamily | Conus catus | DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2) | |
| P04135 | Cal14.6 | Divergent M---L-LTVA | Conus californicus | GCPADCPNTCDSSNKCSPGFP(nh2) | |
| P04140 | Cal16.1 | Divergent MRCLSIFVLL | Conus californicus | ZGCVCNANAKFCCGE(nh2) | |
| P08016 | CIA | A superfamily | Conus catus | NGRCCHPACGKHFSC(nh2) | |
| P08017 | CIB | A superfamily | Conus catus | GCCSNPVCHLEHPNAC(nh2) | |
| P01692 | CIIIA | Conus catus | GRCCEGPNGCSSRWCKDHARCC(nh2) | ||
| P01558 | CnIA | A superfamily | Conus consors | GRCCHPACGKYYSC(nh2) | |
| P00594 | CnIB | A superfamily | Conus consors | CCHPACGKYYSC(nh2) | |
| P04091 | CnIG | Conus consors | CCHPACGKYFKC(nh2) | ||
| P02901 | CnIH | A superfamily | Conus consors | N GR CCHPACGKHFSC(nh2) |
|
| P01693 | CnIIIA | Conus consors | GRCCDVPNACSGRWCRDHAQCC(nh2) | ||
| P03834 | CnIIIC | M superfamily | Conus consors | ZGCCNGPKGCSSKWCRDHARCC(nh2) | |
| P05228 | CnIIID | Conus consors | RCCRWPCPRKIDGEYCGCCL(nh2) | ||
| P04090 | CnIJ | Conus consors | GR CCHPACGGKYFKC(nh2) |
||
| P05353 | CnIK | Conus consors | NGRCCHOACGKYYSC(nh2) | ||
| P05351 | CnIL | A superfamily | Conus consors | DGRCCHPACGKYYSC(nh2) | |
| P05354 | CnVA | Conus consors | ECCHRQLLCCLRFV(nh2) | ||
| P01632 | CnVIIA | O1 superfamily | Conus consors | CKGKGAOCTRL(Mox)YDCCHGSCSSSKGRC(nh2) | |
| P05234 | CnVIIB | O1 superfamily | Conus consors | CKGKGASCRRTSYDCCTGSCRSGKC(nh2) | |
| P05233 | CnVIID | O1 superfamily | Conus consors | CKGKGASCSRTMYNCCSGSCNRGKCG(nh2) | |
| P06935 | Con-ins G1 A chain | Insulin superfamily | Conus geographus (Geography cone) | GVV(Gla)HCCHRPCSNA(Gla)FKKYC(nh2) | |
| P06936 | Con-ins G3 B chain | Insulin superfamily | Conus geographus (Geography cone) | NSDTPKHRCGS(Gla)LADQYVQLCH(nh2) | |
| P01338 | Conantokin-G | B1 superfamily | Conus geographus (Geography cone) | GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN(nh2) | |
| P03535 | Conantokin-Pr3 | Conus parius | GEP(Gla)VAKWA(Gla)GLR(Gla)KAASN(nh2) | ||
| P07405 | Conantokin-SuD | Conus sulcatus | GK(Gla)(Gla)LA(Gla)NAP(Gla)FAR(Gla)LATN(nh2) | ||
| P07407 | Conantokin-SuE | Conus sulcatus | GE(Gla)(Gla)CS(Gla)AI(nh2) | ||
| P01269 | Conantokin-T | Conus tulipa (tulip cone) | GE(Gla)(Gla)YQKML(Gla)NLR(Gla)AEVKKNA(nh2) | ||
| P07533 | ConoCAP-Vila | Conus villepinii | PFCNSFGCYN(nh2) | ||
| P02747 | conolysin-Mt2 | Conus mustelinus | FHPSLWVLIPQYIQLIRKILKS(nh2) | ||
| P03622 | Conomap-Vt | Conus vitulinus | AfVKGSAQRVAHGY(nh2) | ||
| P07536 | ConoNPY-Bt1 | Conus betulinus | TVSDPPARPAVFHSREELMNYVRELNRYFAIVGRPRF(nh2) | ||
| P07537 | ConoNPY-Bt2 | Conus betulinus | TVSDPPARPAVFHSREELMNYVRELNLYFAIVGRPRY(nh2) | ||
| P09721 | conoNPY-Tx1.1 | Conus textile (Cloth-of-gold cone) | RPRF(nh2) | ||
| P09722 | conoNPY-Tx1.2 | Conus textile (Cloth-of-gold cone) | VGRPRF(nh2) | ||
| P09723 | conoNPY-Tx1.3 | Conus textile (Cloth-of-gold cone) | AIVGRPRF(nh2) | ||
| P10035 | Conopressin Ba1 | Conus bayani | CYITNCORG(nh2) | ||
| P08954 | conopressin-G | Conus araneosus | CFIRNCPKG(nh2) | ||
| P08953 | conopressin-G | Conus geographus (Geography cone) | CFIRNCPKG(nh2) | ||
| P01382 | conopressin-G | Conus imperialis | CFIRNCPKG(nh2) | ||
| P08952 | conopressin-G | Conus lividus | CFIRNCPKG(nh2) | ||
| P08951 | conopressin-G | Conus loroisii | CFIRNCPKG(nh2) | ||
| P08940 | conopressin-M | Conus monile | CFIRNCPEG(nh2) | ||
| P01267 | conopressin-S | Conus striatus (Striated cone) | CIIRNCPRG(nh2) | ||
| P03556 | Conopressin-T | Conus tulipa (tulip cone) | CYIQNCLRV(nh2) | ||
| P08700 | Conorfamide-As1a | Conus austini | RIKKPIFIAFPRF(nh2) | ||
| P08701 | Conorfamide-As2a | Conus austini | RIRKPIFIAFPRF(nh2) | ||
| P01317 | Conorfamide-Sr1 | Conus spurius | GPMGWVPVFYRF(nh2) | ||
| P03538 | Conorfamide-Sr2 | Conus spurius | GPM(Gla)DPL(Gla)IIRI(nh2) | ||
| P08699 | Conorfamide-Sr3 | Conus spurius | ATSGPMGWLPVFYRF(nh2) | ||
| P06810 | Conorfamide-Vc1 | Conus victoriae | HSGFLLAWSGPRNRFVRF(nh2) | ||
| P08846 | Conorphin-T[bead] | T superfamily | Conus textile (Cloth-of-gold cone) | NCCRRQICC(nh2) | |
| P08845 | Conorphin-T[globular] | T superfamily | Conus textile (Cloth-of-gold cone) | NCCRRQICC(nh2) | |
| P06918 | Conorphin-T[R5(Cit),ribbon] | synthetic construct | NCCR(Cit)QICC(nh2) | ||
| P06897 | Conorphin-T[ribbon] | T superfamily | Conus textile (Cloth-of-gold cone) | NCCRRQICC(nh2) | |
| P09801 | Contryphan Eu1 | Conus eburneus | GCOPGLWC(nh2) | ||
| P01270 | Contryphan-Am | O2 superfamily | Conus amadis | GCOwDPWC(nh2) | |
| P09754 | Contryphan-Ar1 | Conus araneosus | ES(Gla)CPwHPWC(nh2) | ||
| P09753 | Contryphan-Ar2 | O2 superfamily | Conus araneosus | ES(Gla)CPwKPWC(nh2) | |
| P08776 | Contryphan-Be | Conus betulinus | VVGCOwQPWC(nh2) | ||
| P08777 | Contryphan-Fi | Conus figulinus | VVGCOwQPWC(nh2) | ||
| P06828 | Contryphan-Fib | Conus figulinus | GCOWMPWC(nh2) | ||
| P09757 | Contryphan-Fr1 | O2 superfamily | Conus frigidus | GCOwDPWC(nh2) | |
| P09767 | Contryphan-Fr2 | O2 superfamily | Conus frigidus | GCOwDSWC(nh2) | |
| P01271 | Contryphan-In | Conus inscriptus | GCVlYPWC(nh2) | ||
| P10517 | Contryphan-In2 | Conus inscriptus | RCPWDPWCN(nh2) | ||
| P10518 | Contryphan-In3 | Conus inscriptus | CVLYOWC(nh2) | ||
| P01272 | Contryphan-Lo1 | Conus loroisii | GCPwDPWC(nh2) | ||
| P09766 | Contryphan-Lo2 | O2 superfamily | Conus loroisii | NECPwQPWC(nh2) | |
| P02570 | contryphan-M | O2 superfamily | Conus marmoreus | N(Gla)S(Gla)CPwHPWC(nh2) | |
| P05389 | contryphan-M2 | O2 superfamily | Conus marmoreus | ESECPWHPWC(nh2) | |
| P01372 | Contryphan-R | O2 superfamily | Conus radiatus | GCOwEP(Btr)C(nh2) | |
| P03549 | Contryphan-S | O2 superfamily | Conus striatus (Striated cone) | GCOwEPWC(nh2) | |
| P01318 | Contryphan-Sm | O2 superfamily | Conus stercusmuscarum | GCOwQPWC(nh2) | |
| P02622 | Contryphan-Tx | O2 superfamily | Conus textile (Cloth-of-gold cone) | GCOwQPYC(nh2) | |
| P01309 | Contryphan-Vn | Conus ventricosus | GDCPwKPWC(nh2) | ||
| P07557 | Contryphan-Ze | Conus zeylanicus | VVGCOwQPWC(nh2) | ||
| P02548 | CVIA | O1 superfamily | Conus catus | CKSTGASCRRTSYDCCTGSCRSGRC(nh2) | |
| P01726 | CVIB | O1 superfamily | Conus catus | CKGKGASCRKTMYDCCRGSCRSGRC(nh2) | |
| P01725 | CVIC | O1 superfamily | Conus catus | CKGKGQSCSKLMYDCCTGSCSRRGKC(nh2) | |
| P02549 | CVID | O1 superfamily | Conus catus | CKSKGAKCSKLMYDCCSGSCSGTVGRC(nh2) | |
| P04243 | CVIE | O1 superfamily | Conus catus | CKGKGASCRRTSYDCCTGSCRSGRC(nh2) | |
| P08893 | Czon1107 | Conus zonatus (zoned cone) | GFRSPCPPFC(nh2) | ||
| P02550 | De13a | Conus delessertii | DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG CTH(nh2) |
||
| P01496 | DeVIIA | O1 superfamily | Conus delessertii | ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2) | |
| P00050 | EI | A superfamily | Conus ermineus (Atlantic fish-hunting cone) | RDOCCYHPTCNMSNPQIC(nh2) | |
| P04069 | EIIA | A superfamily | Conus ermineus (Atlantic fish-hunting cone) | ZTOGCCWNPACVKNRC(nh2) | |
| P07538 | EIIB | Conus ermineus (Atlantic fish-hunting cone) | ZTOGCCWHPACGKNRC(nh2) | ||
| P01635 | EIVA | Conus ermineus (Atlantic fish-hunting cone) | GCCGPYONAACHOCGCKVGROOYCDROSGG(nh2) | ||
| P01740 | EIVB | Conus ermineus (Atlantic fish-hunting cone) | GCCGKYONAACHOCGCTVGROOYCDROSGG(nh2) | ||
| P00405 | EpI | A superfamily | Conus episcopatus | GCCSDPRCNMNNPD(sTy)C(nh2) | |
| P04644 | Eu1.6 | A superfamily | Conus eburneus | GCCSNPACMLKNPNLC(nh2) | |
| P01561 | EVIA | O1 superfamily | Conus ermineus (Atlantic fish-hunting cone) | DDCIKOYGFCSLPILKNGLCCSGACVGVCADL(nh2) | |
| P01307 | Gamma-conopressin-vil | Conus villepinii | CLIQDCP(Gla)G(nh2) | ||
| P00074 | GI | A superfamily | Conus geographus (Geography cone) | ECCNPACGRHYSC(nh2) | |
| P00024 | GII | A superfamily | Conus geographus (Geography cone) | ECCHPACGKHFSC(nh2) | |
| P01571 | GIIIA | M superfamily | Conus geographus (Geography cone) | RDCCTOOKKCKDRQCKOQRCCA(nh2) | |
| P01566 | GIIIB | M superfamily | Conus geographus (Geography cone) | RDCCTOORKCKDRRCKOMKCCA(nh2) | |
| P01744 | GIIIC | Conus geographus (Geography cone) | RDCCTOOKKCKDRRCKOLKCCA(nh2) | ||
| P02845 | Gla(2)-TxVI/A | O2 superfamily | Conus textile (Cloth-of-gold cone) | SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2) | |
| P02846 | Gla(2)-TxVI/B | O2 superfamily | Conus textile (Cloth-of-gold cone) | NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2) | |
| P02692 | Gla-MrIII | T superfamily | Conus marmoreus | FCCRTQ(Gla)VCC(Gla)AIKN(nh2) | |
| P01546 | GVIA | O1 superfamily | Conus geographus (Geography cone) | CKSOGSSCSOTSYNCCRSCNOYTKRCY(nh2) | |
| P02582 | GVIIIA | S superfamily | Conus geographus (Geography cone) | GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG CACS(nh2) |
|
| P08941 | GVIIIB | S superfamily | Conus geographus (Geography cone) | SGSTCTCFTSTNCQGSCECLSPPGCYCSNNGIRQRGCSCTC PGT(nh2) |
|
| P00010 | ImI | A superfamily | Conus imperialis | GCCSDPRCAWRC(nh2) | |
| P10519 | In1.1 | Conus inscriptus | EGCCSNPOCRHNHOEVC(nh2) | ||
| P10520 | In1.2 | Conus inscriptus | ZGCCSNPOCRHNHPEVC(nh2) | ||
| P10521 | In1.3 | Conus inscriptus | GCCSHPOCNVNNPHICG(nh2) | ||
| P07434 | KIIIB | Conus kinoshitai | NGCCNCSSKWCRDHSRCC(nh2) | ||
| P08784 | Lo6.1 | Conus longurionis | DQCSYCGIYCCPPKFCTSAGCRSP(nh2) | ||
| P08783 | Lo6.2 | Conus longurionis | SCLSSGALCGIDSNCCNGCNVPRNQCY(nh2) | ||
| P06776 | LsIA | Conus limpusi | SGCCSNPACRVNNPNIC(nh2) | ||
| P02676 | MaI51 | O2 superfamily | Conus marmoreus | QCEDVWMPCTSNWECCSLDCEMYCTQI(nh2) | |
| P00023 | MI | A superfamily | Conus magus (Magus cone) | GRCCHPACGKNYSC(nh2) | |
| P05865 | MIC | Conus magus (Magus cone) | CCHPACGKNYSC(nh2) | ||
| P00039 | MII | A superfamily | Conus magus (Magus cone) | GCCSNPVCHLEHSNLC(nh2) | |
| P01691 | MIIIA | Conus magus (Magus cone) | ZGCCNVPNGCSGRWCRDHAQCC(nh2) | ||
| P09015 | MilIA | Conus milneedwardsi | DMCCHPACMNHFNC(nh2) | ||
| P02527 | MIVA | A superfamily | Conus magus (Magus cone) | AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS COOKRKO(nh2) |
|
| P05409 | Mr026 | I2 superfamily | Conus marmoreus | LCDSYISSELCEHPEETCLLPQSYVLSVESIQTGSVYVLGS VPHISKTS(nh2) |
|
| P05511 | Mr038 | M superfamily | Conus marmoreus | N(Gla)FLTHTFS(Btr)HPTWCPWC(nh2) | |
| P02491 | Mr1.1 | A superfamily | Conus marmoreus | GCCSHPACSVNNPDIC(nh2) | |
| P06002 | Mr1.8a | A superfamily | Conus marmoreus | ECCTHPACHVSNPELC(nh2) | |
| P05431 | Mr1.9 | M superfamily | Conus marmoreus | VCCPFGGCHELCTADD(nh2) | |
| P05411 | Mr14.6 | I2 superfamily | Conus marmoreus | LCDSYISS(Gla)LC(Gla)HP(Gla)ETCLLPQSYVLSVE SIQTGSVYVLEACRIFTKTS(nh2) |
|
| P05416 | Mr3.11 | M superfamily | Conus marmoreus | CCRIACNLKCNOCC(nh2) | |
| P05422 | Mr3.12 | M superfamily | Conus marmoreus | LCCWKEWCHARCTCC(nh2) | |
| P05424 | Mr3.13 | M superfamily | Conus marmoreus | LCCWIHWCHARCTCC(nh2) | |
| P05433 | Mr3.16 | M superfamily | Conus marmoreus | VCCSFGSCDSLCQCCD(nh2) | |
| P05378 | Mr6.12 | O2 superfamily | Conus marmoreus | GCKATWMSCSSGWECCSMSCDMYC(nh2) | |
| P05373 | Mr6.28 | O2 superfamily | Conus marmoreus | QCEDVWMPCTSNWECCSLDCERYCTQI(nh2) | |
| P02696 | MrIIID | M superfamily | Conus marmoreus | CCRLSCGLGCHOCC(nh2) | |
| P02697 | MrIIIE | M superfamily | Conus marmoreus | VCCPFGGCHELCYCCD(nh2) | |
| P01485 | MrIIIF | M superfamily | Conus marmoreus | VCCPFGGCHELCLCCD(nh2) | |
| P02698 | MrIIIG | M superfamily | Conus marmoreus | DCCOLPACPFGCNOCC(nh2) | |
| P01624 | MVIA | O1 superfamily | Conus magus (Magus cone) | DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2) | |
| P01386 | MVIIA | O1 superfamily | Conus magus (Magus cone) | CKGKGAKCSRLMYDCCTGSCRSGKC(nh2) | |
| P01638 | MVIIB | O1 superfamily | Conus magus (Magus cone) | CKGKGASCHRTSYDCCTGSCNRGKC(nh2) | |
| P01397 | OIVA | A superfamily | Conus obscurus | CCGVONAACHOCVCKNTC(nh2) | |
| P01688 | OIVB | A superfamily | Conus obscurus | CCGVONAACPOCVCNKTCG(nh2) | |
| P00006 | OmIA | A superfamily | Conus omaria | GCCSHPACNVNNPHICG(nh2) | |
| P05219 | Pc16a | Conus pictus | SCSCKRNFLCC(nh2) | ||
| P05862 | Pc16c | Conus pictus | SCSCQKHFSCCD(nh2) | ||
| P00038 | PIB | A superfamily | Conus purpurascens | ZSOGCCWNPACVKNRC(nh2) | |
| P01611 | PIIIE | M superfamily | Conus purpurascens | HOOCCLYGKCRRYOGCSSASCCQR(nh2) | |
| P01594 | PIIIF | M superfamily | Conus purpurascens | GOOCCLYGSCROFOGCYNALCCRK(nh2) | |
| P01449 | PIVA | A superfamily | Conus purpurascens | GCCGSYONAACHOCSCKDROSYCGQ(nh2) | |
| P01670 | PIVE | Conus purpurascens | DCCGVKLEMCHPCLCDNSCKNYGK(nh2) | ||
| P01669 | PIVF | Conus purpurascens | DCCGVKLEMCHPCLCDNSCKKSGK(nh2) | ||
| P01539 | PlXIVA | J superfamily | Conus planorbis | FPRPRICNLACRAGIGHKYPFCHCR(nh2) | |
| P10740 | Pn10.1 [bead] | T superfamily | Conus pennaceus | STCCGYRMCVPC(nh2) | |
| P03188 | Pn10.1 [globular] | T superfamily | Conus pennaceus | STCCGYRMCVPC(nh2) | |
| P10739 | Pn10.1 [ribbon] | T superfamily | Conus pennaceus | STCCGYRMCVPC(nh2) | |
| P00051 | PnIA | A superfamily | Conus pennaceus | GCCSLPPCAANNPD(sTy)C(nh2) | |
| P00099 | PnIB | A superfamily | Conus pennaceus | GCCSLPPCALSNPD(sTy)C(nh2) | |
| P02859 | PrXA | C superfamily | Conus parius | TYGIYDAKPOFSCAGLRGGCVLPONLROKFKE(nh2) | |
| P02596 | PVA | T superfamily | Conus purpurascens | GCCPKQMRCCTL(nh2) | |
| P02595 | PVIA | O1 superfamily | Conus purpurascens | EACYAOGTFCGIKOGLCCSEFCLPGVCFG(nh2) | |
| P01356 | PVIIA | O1 superfamily | Conus purpurascens | CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | |
| P01493 | Reg12e | M superfamily | Conus regius | KCCMRPICTCOCCIGP(nh2) | |
| P00028 | Reg1b/Reg1c | A superfamily | Conus regius | GCCSDORCKHQC(nh2) | |
| P00029 | Reg1d | A superfamily | Conus regius | GCCSDPRCKHEC(nh2) | |
| P00031 | Reg1f | A superfamily | Conus regius | DYCCRROOCTLIC(nh2) | |
| P08536 | reg3f | M superfamily | Conus regius | GCCPFPACTTHIICRCC(nh2) | |
| P08560 | reg3g | Conus regius | CCMALCSRYHCLPCC(nh2) | ||
| P08538 | reg3h | Conus regius | GCCSOWNCIQLRACOCCON(nh2) | ||
| P08534 | reg3k | M superfamily | Conus regius | KCCMRPICMCOCCIGP(nh2) | |
| P00032 | RegIIA | A superfamily | Conus regius | GCCSHPACNVNNPHIC(nh2) | |
| P00030 | RgIA [P6O,del13] | A superfamily | Conus regius | GCCSDORCRYRC(nh2) | |
| P01478 | RXIE | I1 superfamily | Conus radiatus | ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC (Btr)VDP(nh2) |
|
| P00001 | SI | A superfamily | Conus striatus (Striated cone) | ICCNPACGPKYSC(nh2) | |
| P00025 | SIA | A superfamily | Conus striatus (Striated cone) | YCCHPACGKNFDC(nh2) | |
| P02707 | SIIIA | M superfamily | Conus striatus (Striated cone) | ZNCCNGGCSSKWCRDHARCC(nh2) | |
| P01615 | SIIIB | M superfamily | Conus striatus (Striated cone) | ZNCCNGGCSSKWCKGHARCC(nh2) | |
| P02524 | SIVA | A superfamily | Conus striatus (Striated cone) | ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2) | |
| P02980 | Sm1.1 | A superfamily | Conus stercusmuscarum | GRCCHPACGONYSC(nh2) | |
| P02903 | Sm1.3 | A superfamily | Conus stercusmuscarum | GCCSNPVCHLEHSN(Mox)C(nh2) | |
| P05838 | Sm1.4 | Conus stercusmuscarum | I(Mox)YDCCSGSCSGYTGRC(nh2) | ||
| P03752 | SrIA | A superfamily | Conus spurius | RTCCSROTCRM(Gla)YP(Gla)LCG(nh2) | |
| P03901 | SrIB | A superfamily | Conus spurius | RTCCSROTCRMEYP(Gla)LCG(nh2) | |
| P01450 | SrVIIA | O1 superfamily | Conus spurius | CLQFGSTCFLGDDDICCSGECFYSGGTFGICS(nh2) | |
| P02802 | SrXIA | I2 superfamily | Conus spurius | CRTEGMSC(Gla)(Gla)NQQCCWRSCCRGECEAPCRFGP(nh2) | |
| P01794 | SVIA | O1 superfamily | Conus striatus (Striated cone) | CRSSGSOCGVTSICCGRCYRGKCT(nh2) | |
| P01793 | SVIB | O1 superfamily | Conus striatus (Striated cone) | CKLKGQSCRKTSYDCCSGSCGRSGKC(nh2) | |
| P09774 | SxIIIC | Conus striolatus | RGCCNGRGGCSSRWCRDHARCC(nh2) | ||
| P02568 | TeAr151 | T superfamily | Conus textile (Cloth-of-gold cone) | VCCRPMQDCCS(nh2) | |
| P01634 | TIA | A superfamily | Conus tulipa (tulip cone) | FNWRCCLIPACRRNHKKFC(nh2) | |
| P04228 | TiIA | Conus tinianus | GGCCSHPACQNNPD(sTy)C(nh2) | ||
| P03755 | Tx10b | Conus textile (Cloth-of-gold cone) | DPCCGYRMCVOC(nh2) | ||
| P03754 | Tx10c | Conus textile (Cloth-of-gold cone) | ZTCCGYRMCVOC(nh2) | ||
| P03753 | Tx1c | Conus textile (Cloth-of-gold cone) | GCCSRPPCIANNPDIC(nh2) | ||
| P02560 | Tx3a | M superfamily | Conus textile (Cloth-of-gold cone) | CCSWDVCDHPSCTCCG(nh2) | |
| P02564 | Tx3f | M superfamily | Conus textile (Cloth-of-gold cone) | RCCKFPCPDSCRYLCC(nh2) | |
| P02565 | Tx3h | M superfamily | Conus textile (Cloth-of-gold cone) | KFCCDSNWCHISDCECCY(nh2) | |
| P05831 | Tx3i | Conus textile (Cloth-of-gold cone) | CCGOTACLAGCKPCC(nh2) | ||
| P02561 | Tx5.1 | T superfamily | Conus textile (Cloth-of-gold cone) | CCQTFYWCCVQ(nh2) | |
| P05827 | Tx5.2 | Conus textile (Cloth-of-gold cone) | CCPPVIWCC(nh2) | ||
| P05828 | Tx5.3 | Conus textile (Cloth-of-gold cone) | QTCCGSKVFCC(nh2) | ||
| P05833 | Tx5.5 | Conus textile (Cloth-of-gold cone) | NIQIICCKHTPKCCT(nh2) | ||
| P03756 | Tx5c | Conus textile (Cloth-of-gold cone) | KPCCSIHDNSCCGI(nh2) | ||
| P03758 | Tx5d | Conus textile (Cloth-of-gold cone) | NIQIICCKHTPACCT(nh2) | ||
| P05864 | Tx5e | Conus textile (Cloth-of-gold cone) | PCCSKLHDNSCCGL(nh2) | ||
| P05837 | Tx6.6 | O1 superfamily | Conus textile (Cloth-of-gold cone) | DCQEKWDYCPVPFLGSRYCCDGFICPSFFCA(nh2) | |
| P02881 | TxIA | A superfamily | Conus textile (Cloth-of-gold cone) | GCCSRPPCIANNPDLC(nh2) | |
| P05832 | TxIC | T superfamily | Conus textile (Cloth-of-gold cone) | DKQTCCGYRMCVOC(nh2) | |
| P06831 | TxID | Conus textile (Cloth-of-gold cone) | GCCSHPVCSAMSPIC(nh2) | ||
| P02563 | TxIIIB | M superfamily | Conus textile (Cloth-of-gold cone) | CCPPVACNMGCKPCC(nh2) | |
| P02562 | TxIIIC | M superfamily | Conus textile (Cloth-of-gold cone) | CCRTCFGCTOCC(nh2) | |
| P02559 | TxIXA | P superfamily | Conus textile (Cloth-of-gold cone) | GCNNSCQ(Gla)HSDC(Gla)SHCICTFRGCGAVN(nh2) | |
| P03170 | TxMLKM-021 | M superfamily | Conus textile (Cloth-of-gold cone) | VCCPFGGCHELCQCCE(nh2) | |
| P01517 | TxVIIA | O2 superfamily | Conus textile (Cloth-of-gold cone) | CGGYSTYC(Gla)VDS(Gla)CCSDNCVRSYCTLF(nh2) | |
| P02551 | TxX | I2 superfamily | Conus textile (Cloth-of-gold cone) | SCDS(Gla)FSS(Gla)FC(Gla)RP(Gla)(Gla)SCSCS THTCCHWARRDQCMKPQRCISAQKGN(nh2) |
|
| P02552 | TxXI | I2 superfamily | Conus textile (Cloth-of-gold cone) | CIP(Gla)GSSCSSSGSCCHKSCCRWTCNQPCLIP(nh2) | |
| P02539 | VcIA | A superfamily | Conus victoriae | GCCSDORCNYDHP(Gla)IC(nh2) | |
| P02540 | VcVA | T superfamily | Conus victoriae | CCPGKOCCRI(nh2) | |
| P02541 | VcVB | T superfamily | Conus victoriae | CCQTFYWCCGQ(nh2) | |
| P02788 | Vi1361 | Conus virgo | ZCCPTMPECCRI(nh2) | ||
| P06858 | ViIA | A superfamily | Conus virgo | RDCCSNPPCAHNNPDC(nh2) | |
| P01672 | ViVA | T superfamily | Conus virgo | ZCCITIPECCRI(nh2) | |
| P01671 | ViVB | T superfamily | Conus virgo | ZCCPTIPECCRV(nh2) | |
| P02836 | ViXVA | V superfamily | Conus virgo | DCTTCAGEECCGRCTCPWGDNCSCIEW(nh2) | |
| P01390 | Vn6A | Conus ventricosus | EDCIAVGQLCVFWNIGRPCCSGLCVFACTVKLP(nh2) | ||
| P04985 | Vr3-T05 | M superfamily | Conus varius | EIILHALGTRCCSWDVCDHPSCTCC(nh2) |
Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6
ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.
The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).
Contacts:
David Craik
Quentin Kaas
Last updated: Monday 2 October 2023