ID | Name | Gene superfamily | Organism | Sequence | |
---|---|---|---|---|---|
P09947 | [S4Hse]PeIA | synthetic construct | GCC(Hse)HPACSVNHPELC(nh2) | ||
P09944 | [S4I]PeIA | synthetic construct | GCCIHPACSVNHPELC(nh2) | ||
P09946 | [S4L]PeIA | synthetic construct | GCCLHPACSVNHPELC(nh2) | ||
P09945 | [S4T]PeIA | synthetic construct | GCCTHPACSVNHPELC(nh2) | ||
P09943 | [S4V]PeIA | synthetic construct | GCCVHPACSVNHPELC(nh2) | ||
P04258 | Ac-AuIB | synthetic construct | (Ac)GCCSYPPCFATNPDC(nh2) | ||
P04404 | Ac-ImI | synthetic construct | (Ac)GCCSDPRCAWRC(nh2) | ||
P04343 | Ac-L1 | synthetic construct | (Ac)LOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P03833 | Ac1.1a | A superfamily | Conus achatinus | NGRCCHPACGKHFNC(nh2) | |
P02485 | Ac1.1b | A superfamily | Conus achatinus | NGRCCHPACGKHFSC(nh2) | |
P04393 | Ac1.1b [Del1] | synthetic construct | GRCCHPACGKHFSC(nh2) | ||
P02487 | Ac4.2 | A superfamily | Conus achatinus | APWMVVTATTNCCGYTGPACHPCLCTQSC(nh2) | |
P02489 | Ac4.3a | A superfamily | Conus achatinus | QKELVVTATTTCCGYNPMTSCPRCMCDSSCNKKKK(nh2) | |
P02490 | Ac4.3b | A superfamily | Conus achatinus | QKELVPSKITTCCGYSPGTACPSCMCTNTCKKKNKKP(nh2) | |
P08385 | Am1.3 | A superfamily | Conus amadis | GCCSVPPCIANHPELC(nh2) | |
P01630 | Am2766 | O1 superfamily | Conus amadis | CKQAGESCDIFSQNCCVGTCAFICIE(nh2) | |
P08380 | Am3.1 | M superfamily | Conus amadis | GCCPALACAMGCRPCC(nh2) | |
P08387 | Am3.3 | M superfamily | Conus amadis | GCCMPLSCMLLCEPCC(nh2) | |
P08393 | Am3.4 | M superfamily | Conus amadis | CCKYGWTCWLGCSPCC(nh2) | |
P02501 | AnIA | Conus anemone | CCSHPACAANNQD(sTy)C(nh2) | ||
P00015 | AnIB | Conus anemone | GGCCSHPACAANNQD(sTy)C(nh2) | ||
P04396 | AnIB [Del1] | synthetic construct | GCCSHPACAANNQD(sTy)C(nh2) | ||
P04394 | AnIB [sTy16Y] | synthetic construct | GGCCSHPACAANNQDYC(nh2) | ||
P00017 | AnIC | Conus anemone | GGCCSHPACFASNPD(sTy)C(nh2) | ||
P04232 | Ar1446 | Conus araneosus | CCRLACGLGCHOCC(nh2) | ||
P05524 | As25a | Conus austini | CKCOSCNFNDVTENCKCCIFRQO(nh2) | ||
P08781 | Asi14.1 | Conus asiaticus | SCGYPCSHCGIPGCYPG(nh2) | ||
P08782 | Asi3.1 | Conus asiaticus | CCQWPCSHGCIPCCY(nh2) | ||
P00404 | AuIA | A superfamily | Conus aulicus | GCCSYPPCFATNSDYC(nh2) | |
P00095 | AuIB | A superfamily | Conus aulicus | GCCSYPPCFATNPDC(nh2) | |
P08448 | AuIB [N12A,ribbon] | synthetic construct | GCCSYPPCFATAPDC(nh2) | ||
P04480 | AuIB [ribbon] | synthetic construct | GCCSYPPCFATNPDC(nh2) | ||
P08440 | AuIB[C2H,C8F] | synthetic construct | GHCSYPPFFATNPDC(nh2) | ||
P08450 | AuIB[D14A,ribbon] | synthetic construct | GCCSYPPCFATNPAC(nh2) | ||
P08796 | AuIB[D14A] | synthetic construct | GCCSYPPCFATNPAC(nh2) | ||
P07421 | AuIB[F9(Nal)] | synthetic construct | GCCSYPPC(Nal)ATNPDC(nh2) | ||
P08446 | AuIB[F9A,ribbon] | synthetic construct | GCCSYPPCAATNPDC(nh2) | ||
P07416 | AuIB[F9A] | synthetic construct | GCCSYPPCAATNPDC(nh2) | ||
P07418 | AuIB[F9G] | synthetic construct | GCCSYPPCGATNPDC(nh2) | ||
P07420 | AuIB[F9W] | synthetic construct | GCCSYPPCWATNPDC(nh2) | ||
P07419 | AuIB[F9Y] | synthetic construct | GCCSYPPCYATNPDC(nh2) | ||
P08441 | AuIB[G1A,ribbon] | synthetic construct | ACCSYPPCFATNPDC(nh2) | ||
P07414 | AuIB[G1A] | synthetic construct | ACCSYPPCFATNPDC(nh2) | ||
P08794 | AuIB[N12A] | synthetic construct | GCCSYPPCFATAPDC(nh2) | ||
P07422 | AuIB[N12H] | synthetic construct | GCCSYPPCFATHPDC(nh2) | ||
P08449 | AuIB[P13A,ribbon] | synthetic construct | GCCSYPPCFATNADC(nh2) | ||
P08795 | AuIB[P13A] | synthetic construct | GCCSYPPCFATNADC(nh2) | ||
P08444 | AuIB[P6A,ribbon] | synthetic construct | GCCSYAPCFATNPDC(nh2) | ||
P07415 | AuIB[P6A] | synthetic construct | GCCSYAPCFATNPDC(nh2) | ||
P08445 | AuIB[P7A,ribbon] | synthetic construct | GCCSYPACFATNPDC(nh2) | ||
P08792 | AuIB[P7A] | synthetic construct | GCCSYPACFATNPDC(nh2) | ||
P08451 | AuIB[P7A] | synthetic construct | GCCSYPACFATNPDC(nh2) | ||
P08442 | AuIB[S4A,ribbon] | synthetic construct | GCCAYPPCFATNPDC(nh2) | ||
P08786 | AuIB[S4A] | synthetic construct | GCCAYPPCFATNPDC(nh2) | ||
P08447 | AuIB[T11A,ribbon] | synthetic construct | GCCSYPPCFAANPDC(nh2) | ||
P08793 | AuIB[T11A] | synthetic construct | GCCSYPPCFAANPDC(nh2) | ||
P08443 | AuIB[Y5A,ribbon] | synthetic construct | GCCSAPPCFATNPDC(nh2) | ||
P07417 | AuIB[Y5A] | synthetic construct | GCCSAPPCFATNPDC(nh2) | ||
P00407 | AuIC | A superfamily | Conus aulicus | GCCSYPPCFATNSGYC(nh2) | |
P10037 | Ba5.1 | T superfamily | Conus bayani | SCCGSSNTGSCC(nh2) | |
P02531 | Bn1.2 | Conus bandanus | ECCTHPACHVSHPELC(nh2) | ||
P02483 | Bn1.3 | A superfamily | Conus bandanus | DYCCHRGPCMVWC(nh2) | |
P02635 | BnIA | A superfamily | Conus bandanus | GCCSHPACSVNNPDIC(nh2) | |
P03551 | Bromocontryphan-S | Conus striatus (Striated cone) | GCO(Btr)EPWC(nh2) | ||
P03552 | Bromoheptapeptide Im | Conus imperialis | ZCGQA(Btr)C(nh2) | ||
P09066 | Bt1.10 | A superfamily | Conus betulinus | GGCCSHPACGVNHPELC(nh2) | |
P07501 | Bt1.8 | Conus betulinus | GCCSNPACILNNPNQC(nh2) | ||
P09059 | Bt5.5 | T superfamily | Conus betulinus | SECCIRNFLCC(nh2) | |
P09062 | Bt5.6 | T superfamily | Conus betulinus | RPCCPRDTWCC(nh2) | |
P02526 | BtX | I2 superfamily | Conus betulinus | CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR HP(nh2) |
|
P04599 | Bu10 | Conus bullatus | CKLSGYRCKRPKQCCNLSCGNYMC(nh2) | ||
P04597 | Bu17 | Conus bullatus | GLYCCQPKPNGQMMCNRWCEINSRCC(nh2) | ||
P04575 | Bu19 | A superfamily | Conus bullatus | GCCHDIFCKHNNPDIC(nh2) | |
P04582 | Bu23 | A superfamily | Conus bullatus | LNDLVPQYWTECCGRIGPHCSRCICPEVVCPKN(nh2) | |
P04584 | Bu24 | A superfamily | Conus bullatus | YWTECCGRIGPHCSRCICPEVACPKN(nh2) | |
P04586 | Bu25 | A superfamily | Conus bullatus | YWTECCGRIGPHCSRCICPGVVCPKR(nh2) | |
P04590 | Bu27 | Conus bullatus | AO(Gla)LVVTATTTCCGYDOMTICOOCMCTHSCOOKRKO(nh2) | ||
P04592 | Bu28 | Conus bullatus | VPVGPALAYACSVMCAKGYDTVVCTCTRRR(nh2) | ||
P04616 | Bu5 | O1 superfamily | Conus bullatus | SCTDDFEPCEAGFENCCSKSCFEFEDVYVC(nh2) | |
P04618 | Bu6 | O1 superfamily | Conus bullatus | DSCVPDGDSCLFSRIPCCGTCSSRSKSCV(nh2) | |
P04622 | Bu8 | Conus bullatus | CKRKGSSCRRTSYDCCTGSCRNGKC(nh2) | ||
P10401 | Bu8[N22A] | synthetic construct | CKRKGSSCRRTSYDCCTGSCRAGKC(nh2) | ||
P10406 | Bu8[N22S] | synthetic construct | CKRKGSSCRRTSYDCCTGSCRSGKC(nh2) | ||
P10395 | Bu8[R3A] | synthetic construct | CKAKGSSCRRTSYDCCTGSCRNGKC(nh2) | ||
P10402 | Bu8[R3G] | synthetic construct | CKGKGSSCRRTSYDCCTGSCRNGKC(nh2) | ||
P10398 | Bu8[R9A] | synthetic construct | CKRKGSSCARTSYDCCTGSCRNGKC(nh2) | ||
P10403 | Bu8[R9S] | synthetic construct | CKRKGSSCSRTSYDCCTGSCRNGKC(nh2) | ||
P10400 | Bu8[S12A] | synthetic construct | CKRKGSSCRRTAYDCCTGSCRNGKC(nh2) | ||
P10405 | Bu8[S12M] | synthetic construct | CKRKGSSCRRTMYDCCTGSCRNGKC(nh2) | ||
P10397 | Bu8[S6A] | synthetic construct | CKRKGASCRRTSYDCCTGSCRNGKC(nh2) | ||
P10396 | Bu8[S7A] | synthetic construct | CKRKGSACRRTSYDCCTGSCRNGKC(nh2) | ||
P10399 | Bu8[T11A] | synthetic construct | CKRKGSSCRRASYDCCTGSCRNGKC(nh2) | ||
P10404 | Bu8[T11L] | synthetic construct | CKRKGSSCRRLSYDCCTGSCRNGKC(nh2) | ||
P00026 | BuIA | A superfamily | Conus bullatus | GCCSTPPCAVLYC(nh2) | |
P05871 | BuIA[A9S] | synthetic construct | GCCSTPPCSVLYC(nh2) | ||
P08439 | BuIA[C2H,C8F] | synthetic construct | GHCSTPPFAVLYC(nh2) | ||
P05873 | BuIA[L11A] | synthetic construct | GCCSTPPCAVAYC(nh2) | ||
P05869 | BuIA[P6O] | synthetic construct | GCCSTOPCAVLYC(nh2) | ||
P05870 | BuIA[P7O] | synthetic construct | GCCSTPOCAVLYC(nh2) | ||
P05867 | BuIA[S4A] | synthetic construct | GCCATPPCAVLYC(nh2) | ||
P09954 | BuIA[T5A,P6O] | Conus bullatus | GCCSAOPCAVLYCG(nh2) | ||
P05868 | BuIA[T5A] | synthetic construct | GCCSAPPCAVLYC(nh2) | ||
P05872 | BuIA[V10A] | synthetic construct | GCCSTPPCAALYC(nh2) | ||
P05874 | BuIA[Y12A] | synthetic construct | GCCSTPPCAVLAC(nh2) | ||
P10453 | BuIA[Y12F] | synthetic construct | GCCSTPPCAVLFC(nh2) | ||
P03623 | BuIIIA | M superfamily | Conus bullatus | VTDRCCKGKRECGRWCRDHSRCC(nh2) | |
P05364 | BuIIIA[del1-4] | synthetic construct | CCKNGKRGCGRWCRDHSRCC(nh2) | ||
P03625 | BuIIIB | M superfamily | Conus bullatus | VGERCCKNGKRGCGRWCRDHSRCC(nh2) | |
P06981 | BuIIIB[C13A,C24A] | synthetic construct | VGERCCKNGKRGAGRWCRDHSRCA(nh2) | ||
P06979 | BuIIIB[C5A,C17A] | synthetic construct | VGERACKNGKRGCGRWARDHSRCC(nh2) | ||
P06983 | BuIIIB[C5U,C13A,C17U,C24A] | synthetic construct | VGER(Sec)CKNGKRGAGRW(Sec)RDHSRCA(nh2) | ||
P06982 | BuIIIB[C5U,C6A,C17U,C23A] | synthetic construct | VGER(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P06998 | BuIIIB[C5U,C6A,C17U,D19A,C23A] | synthetic construct | VGER(Sec)AKNGKRGCGRW(Sec)RAHSRAC(nh2) | ||
P06999 | BuIIIB[C5U,C6A,C17U,H20A,C23A] | synthetic construct | VGER(Sec)AKNGKRGCGRW(Sec)RDASRAC(nh2) | ||
P06997 | BuIIIB[C5U,C6A,C17U,R18A,C23A] | synthetic construct | VGER(Sec)AKNGKRGCGRW(Sec)ADHSRAC(nh2) | ||
P07001 | BuIIIB[C5U,C6A,C17U,R22A,C23A] | synthetic construct | VGER(Sec)AKNGKRGCGRW(Sec)RDHSAAC(nh2) | ||
P07000 | BuIIIB[C5U,C6A,C17U,S21A,C23A] | synthetic construct | VGER(Sec)AKNGKRGCGRW(Sec)RDHARAC(nh2) | ||
P06993 | BuIIIB[C5U,C6A,G12A,C17U,C23A] | synthetic construct | VGER(Sec)AKNGKRACGRW(Sec)RDHSRAC(nh2) | ||
P06994 | BuIIIB[C5U,C6A,G14A,C17U,C23A] | synthetic construct | VGER(Sec)AKNGKRGCARW(Sec)RDHSRAC(nh2) | ||
P06990 | BuIIIB[C5U,C6A,G9A,C17U,C23A] | synthetic construct | VGER(Sec)AKNAKRGCGRW(Sec)RDHSRAC(nh2) | ||
P06991 | BuIIIB[C5U,C6A,K10A,C17U,C23A] | synthetic construct | VGER(Sec)AKNGARGCGRW(Sec)RDHSRAC(nh2) | ||
P06988 | BuIIIB[C5U,C6A,K7A,C17U,C23A] | synthetic construct | VGER(Sec)AANGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P06989 | BuIIIB[C5U,C6A,N8A,C17U,C23A] | synthetic construct | VGER(Sec)AKAGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P06992 | BuIIIB[C5U,C6A,R11A,C17U,C23A] | synthetic construct | VGER(Sec)AKNGKAGCGRW(Sec)RDHSRAC(nh2) | ||
P06995 | BuIIIB[C5U,C6A,R15A,C17U,C23A] | synthetic construct | VGER(Sec)AKNGKRGCGAW(Sec)RDHSRAC(nh2) | ||
P06996 | BuIIIB[C5U,C6A,W16A,C17U,C23A] | synthetic construct | VGER(Sec)AKNGKRGCGRA(Sec)RDHSRAC(nh2) | ||
P06980 | BuIIIB[C6A,C23A] | synthetic construct | VGERCAKNGKRGCGRWCRDHSRAC(nh2) | ||
P07003 | BuIIIB[E3(Dab),C5U,C6A,C17U,C23A] | synthetic construct | VG(Dab)R(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P07004 | BuIIIB[E3(Dap),C5U,C6A,C17U,C23A] | synthetic construct | VG(Dap)R(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P07002 | BuIIIB[E3(Gla),C5U,C6A,C17U,C23A] | synthetic construct | VG(Gla)R(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P07005 | BuIIIB[E3(Orn),C5U,C6A,C17U,C23A] | synthetic construct | VG(Orn)R(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P06986 | BuIIIB[E3A,C5U,C6A,C17U,C23A] | synthetic construct | VGAR(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P05362 | BuIIIB[E3A] | synthetic construct | VGARCCKNGKRGCGRWCRDHSRCC(nh2) | ||
P07008 | BuIIIB[E3H,C5U,C6A,C17U,C23A] | synthetic construct | VGHR(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P07006 | BuIIIB[E3K,C5U,C6A,C17U,C23A] | synthetic construct | VGKR(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P07007 | BuIIIB[E3R,C5U,C6A,C17U,C23A] | synthetic construct | VGRR(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P06985 | BuIIIB[G2A,C5U,C6A,C17U,C23A] | synthetic construct | VAER(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P05361 | BuIIIB[G2A] | synthetic construct | VAERCCKNGKRGCGRWCRDHSRCC(nh2) | ||
P05359 | BuIIIB[G2a] | synthetic construct | VaERCCKNGKRGCGRWCRDHSRCC(nh2) | ||
P06987 | BuIIIB[R4A,C5U,C6A,C17U,C23A] | synthetic construct | VGEA(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P05363 | BuIIIB[R4A] | synthetic construct | VGEACCKNGKRGCGRWCRDHSRCC(nh2) | ||
P06984 | BuIIIB[V1A,C5U,C6A,C17U,C23A] | synthetic construct | AGER(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2) | ||
P05360 | BuIIIB[V1A] | synthetic construct | AGERCCKNGKRGCGRWCRDHSRCC(nh2) | ||
P03628 | BuIIIC | M superfamily | Conus bullatus | IVDRCCNKGNGKRGCSRWCRDHSRCC(nh2) | |
P09973 | C1.3 | A superfamily | Conus catus | GCCSNPVCHLEHSNLC(nh2) | |
P09974 | C6.2 | O1 superfamily | Conus catus | DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2) | |
P04133 | Cal14.13b | Divergent MKLCVVIVLL | Conus californicus | GIWCDPPCPEGETCRGGECSDEFNGDM(nh2) | |
P04134 | Cal14.13c | Divergent MKLCVVIVLL | Conus californicus | GIWCDPPCPEGETCRGGECSDEFNGDL(nh2) | |
P04135 | Cal14.6 | Divergent M---L-LTVA | Conus californicus | GCPADCPNTCDSSNKCSPGFP(nh2) | |
P04140 | Cal16.1 | Divergent MRCLSIFVLL | Conus californicus | ZGCVCNANAKFCCGE(nh2) | |
P04917 | CalXXIXA | Conus californicus | ROKCCCVCGVVGRKCCSTWDKCHOVHLOCOSS(nh2) | ||
P08897 | Cca1669 amidated | synthetic construct | RDCGKMCEEETWKG(nh2) | ||
P09071 | Ch1.1 | A superfamily | Conus chiangi | GCCSDPRCAWRC(nh2) | |
P08016 | CIA | A superfamily | Conus catus | NGRCCHPACGKHFSC(nh2) | |
P08017 | CIB | A superfamily | Conus catus | GCCSNPVCHLEHPNAC(nh2) | |
P01692 | CIIIA | Conus catus | GRCCEGPNGCSSRWCKDHARCC(nh2) | ||
P02855 | CMrVIA [K6P] amidated | synthetic construct | VCCGYPLCHOC(nh2) | ||
P02856 | CMrVIA amidated | synthetic construct | VCCGYKLCHOC(nh2) | ||
P01558 | CnIA | A superfamily | Conus consors | GRCCHPACGKYYSC(nh2) | |
P00594 | CnIB | A superfamily | Conus consors | CCHPACGKYYSC(nh2) | |
P04091 | CnIG | Conus consors | CCHPACGKYFKC(nh2) | ||
P02901 | CnIH | A superfamily | Conus consors | N GR CCHPACGKHFSC(nh2) |
|
P01693 | CnIIIA | Conus consors | GRCCDVPNACSGRWCRDHAQCC(nh2) | ||
P03834 | CnIIIC | M superfamily | Conus consors | ZGCCNGPKGCSSKWCRDHARCC(nh2) | |
P05228 | CnIIID | Conus consors | RCCRWPCPRKIDGEYCGCCL(nh2) | ||
P04090 | CnIJ | Conus consors | GR CCHPACGGKYFKC(nh2) |
||
P05353 | CnIK | Conus consors | NGRCCHOACGKYYSC(nh2) | ||
P05351 | CnIL | A superfamily | Conus consors | DGRCCHPACGKYYSC(nh2) | |
P05354 | CnVA | Conus consors | ECCHRQLLCCLRFV(nh2) | ||
P03996 | CnVIB | Conus consors | DECFSOGTFCGTKOGLCCSARCFSFFCISLEF(nh2) | ||
P03997 | CnVIC | Conus consors | DECFSOGTFCGIKOGLCCSARCFSFFCISLEF(nh2) | ||
P03998 | CnVID | Conus consors | DECFSOGTFCGFKOGLCCSARCFSFFCISLEF(nh2) | ||
P01632 | CnVIIA | O1 superfamily | Conus consors | CKGKGAOCTRL(Mox)YDCCHGSCSSSKGRC(nh2) | |
P05234 | CnVIIB | O1 superfamily | Conus consors | CKGKGASCRRTSYDCCTGSCRSGKC(nh2) | |
P05232 | CnVIIC | O1 superfamily | Conus consors | CKGTGKOCSRIAYNCCTGSCRSGKC(nh2) | |
P05233 | CnVIID | O1 superfamily | Conus consors | CKGKGASCSRTMYNCCSGSCNRGKCG(nh2) | |
P06935 | Con-ins G1 A chain | Insulin superfamily | Conus geographus (Geography cone) | GVV(Gla)HCCHRPCSNA(Gla)FKKYC(nh2) | |
P06936 | Con-ins G3 B chain | Insulin superfamily | Conus geographus (Geography cone) | NSDTPKHRCGS(Gla)LADQYVQLCH(nh2) | |
P09802 | Conantokin Eu3 | Conus eburneus | GGEPRVEASRERLQEIGR(nh2) | ||
P04643 | Conantokin-Eu2 | Conus eburneus | GQEERAEASYEKLLEI(nh2) | ||
P01338 | Conantokin-G | B1 superfamily | Conus geographus (Geography cone) | GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN(nh2) | |
P05725 | Conantokin-G2 | B1 superfamily | Conus geographus (Geography cone) | GEEEVQENQELIREASN(nh2) | |
P05699 | Conantokin-G[+10Gla,Gla10Buc,Gla14Buc] | synthetic construct | GE(Gla)(Gla)LQ(Gla)NQ(Gla)(Buc)LIR(Buc)KS N(nh2) |
||
P07643 | conantokin-G[+10O] | synthetic construct | GE(Gla)(Gla)LQ(Gla)NQO(Gla)LIR(Gla)KSN(nh2) | ||
P05698 | Conantokin-G[Gla10Bsc,Gla14Bsc] | synthetic construct | GE(Gla)(Gla)LQ(Gla)NQ(Bsc)LIR(Bsc)KSN(nh2) | ||
P05697 | Conantokin-G[Gla10Buc,Gla14Buc] | synthetic construct | GE(Gla)(Gla)LQ(Gla)NQ(Buc)LIR(Buc)KSN(nh2) | ||
P05700 | Conantokin-G[Gla7Buc,Gla14Buc] | synthetic construct | GE(Gla)(Gla)LQ(Huc)NQ(Gla)LIR(Buc)KSN(nh2) | ||
P02637 | Conantokin-L | B1 superfamily | Conus lynceus | GE(Gla)(Gla)VAKMAA(Gla)LAR(Gla)DAVN(nh2) | |
P04501 | Conantokin-L2.2 | B1 superfamily | Conus litteratus | GPEEDSETTVEELHEI(nh2) | |
P09939 | Conantokin-Lt4 | Conus litteratus | GPEEDSETTVEELHEI(nh2) | ||
P03535 | Conantokin-Pr3 | Conus parius | GEP(Gla)VAKWA(Gla)GLR(Gla)KAASN(nh2) | ||
P05841 | Conantokin-Rl2 | B1 superfamily | Conus rolani | GE(Gla)(Gla)LA(Gla)KAO(Gla)FAR(Gla)LAN(nh2) | |
P05846 | conantokin-Rl2[delO10] | synthetic construct | GE(Gla)(Gla)LA(Gla)KA(Gla)FAR(Gla)LAN(nh2) | ||
P05848 | Conantokin-Rl2[K8N,A9Q,del10O] | synthetic construct | GE(Gla)(Gla)LA(Gla)NQ(Gla)FAR(Gla)LAN(nh2) | ||
P05847 | Conantokin-Rl2[K8Nle] | synthetic construct | GE(Gla)(Gla)LA(Gla)(Nle)AO(Gla)FAR(Gla)LA N(nh2) |
||
P05844 | Conantokin-Rl2[L5Y] | synthetic construct | GE(Gla)(Gla)YA(Gla)KAO(Gla)FAR(Gla)LAN(nh2) | ||
P05845 | conantokin-Rl2[O10A] | synthetic construct | GE(Gla)(Gla)LA(Gla)KAA(Gla)FAR(Gla)LAN(nh2) | ||
P07642 | conantokin-Rl2[O10P] | synthetic construct | GE(Gla)(Gla)LA(Gla)KAP(Gla)FAR(Gla)LAN(nh2) | ||
P05851 | Conantokin-Rl3 | B1 superfamily | Conus rolani | GE(Gla)(Gla)LS(Gla)NAV(Gla)FAR(Gla)LAN(nh2) | |
P07401 | Conantokin-SuB | Conus sulcatus | GE(Gla)(Gla)YS(Gla)AI(nh2) | ||
P07411 | Conantokin-SuB[A8F] | synthetic construct | GE(Gla)(Gla)YS(Gla)FI(nh2) | ||
P07413 | Conantokin-SuC[A6S,F8A,del10-18] | synthetic construct | DD(Gla)(Gla)YS(Gla)AI(nh2) | ||
P07410 | Conantokin-SuC[del10-18] | synthetic construct | DD(Gla)(Gla)YA(Gla)FI(nh2) | ||
P07405 | Conantokin-SuD | Conus sulcatus | GK(Gla)(Gla)LA(Gla)NAP(Gla)FAR(Gla)LATN(nh2) | ||
P07407 | Conantokin-SuE | Conus sulcatus | GE(Gla)(Gla)CS(Gla)AI(nh2) | ||
P01269 | Conantokin-T | Conus tulipa (tulip cone) | GE(Gla)(Gla)YQKML(Gla)NLR(Gla)AEVKKNA(nh2) | ||
P07533 | ConoCAP-Vila | Conus villepinii | PFCNSFGCYN(nh2) | ||
P07532 | ConoCAP-Vilb | Conus villepinii | VFCNGFTGCG(nh2) | ||
P07534 | ConoCAP-Vilc | Conus villepinii | LFCNGYGGCRG(nh2) | ||
P02747 | conolysin-Mt2 | Conus mustelinus | FHPSLWVLIPQYIQLIRKILKS(nh2) | ||
P03622 | Conomap-Vt | Conus vitulinus | AfVKGSAQRVAHGY(nh2) | ||
P08923 | conomarphin-Ac1 amidated | synthetic construct | NYYLYOAROENSwwT(nh2) | ||
P08926 | conomarphin-Ac1[E10(Gla), W14(Gla)] amidated | synthetic construct | NYYLYOARO(Gla)NSw(Gla)T(nh2) | ||
P06673 | conomarphin-Vc2 | M superfamily | Conus victoriae | GWHYHPYQNPKPT(nh2) | |
P07536 | ConoNPY-Bt1 | Conus betulinus | TVSDPPARPAVFHSREELMNYVRELNRYFAIVGRPRF(nh2) | ||
P07537 | ConoNPY-Bt2 | Conus betulinus | TVSDPPARPAVFHSREELMNYVRELNLYFAIVGRPRY(nh2) | ||
P09721 | conoNPY-Tx1.1 | Conus textile (Cloth-of-gold cone) | RPRF(nh2) | ||
P09722 | conoNPY-Tx1.2 | Conus textile (Cloth-of-gold cone) | VGRPRF(nh2) | ||
P09723 | conoNPY-Tx1.3 | Conus textile (Cloth-of-gold cone) | AIVGRPRF(nh2) | ||
P10146 | Conophysin Ba3 | Conus bayani | AVQPTRQCM(nh2)CGPGGVGQCVGPSVCCGLGLGCLMGTP ETEVCQKENESSVPCAISGRRCGMDNTGNCVADGICCVEDA CSFNSLCRVDTDQEDSVSARQELLTLI |
||
P10035 | Conopressin Ba1 | Conus bayani | CYITNCORG(nh2) | ||
P10143 | Conopressin Ba2 | Conus bayani | CFLGNCLND(nh2) | ||
P10145 | Conopressin Ba3 | Conus bayani | CFIRNCPRG(nh2) | ||
P08903 | Conopressin M1 amidated | synthetic construct | CFPGNCPDS(nh2) | ||
P08905 | Conopressin M2 amidated | synthetic construct | CFLGNCPDS(nh2) | ||
P05544 | conopressin-Cn | Conus consors | CYIRDCPE(nh2) | ||
P08951 | conopressin-G | Conus loroisii | CFIRNCPKG(nh2) | ||
P08953 | conopressin-G | Conus geographus (Geography cone) | CFIRNCPKG(nh2) | ||
P08952 | conopressin-G | Conus lividus | CFIRNCPKG(nh2) | ||
P01382 | conopressin-G | Conus imperialis | CFIRNCPKG(nh2) | ||
P08954 | conopressin-G | Conus araneosus | CFIRNCPKG(nh2) | ||
P08940 | conopressin-M | Conus monile | CFIRNCPEG(nh2) | ||
P01267 | conopressin-S | Conus striatus (Striated cone) | CIIRNCPRG(nh2) | ||
P03556 | Conopressin-T | Conus tulipa (tulip cone) | CYIQNCLRV(nh2) | ||
P08700 | Conorfamide-As1a | Conus austini | RIKKPIFIAFPRF(nh2) | ||
P08701 | Conorfamide-As2a | Conus austini | RIRKPIFIAFPRF(nh2) | ||
P09977 | Conorfamide-Ep1 | Conus episcopatus | NFGILFYFTRPRNNFVRI(nh2) | ||
P01317 | Conorfamide-Sr1 | Conus spurius | GPMGWVPVFYRF(nh2) | ||
P03538 | Conorfamide-Sr2 | Conus spurius | GPM(Gla)DPL(Gla)IIRI(nh2) | ||
P08699 | Conorfamide-Sr3 | Conus spurius | ATSGPMGWLPVFYRF(nh2) | ||
P08367 | Conorfamide-Tx1 | Conus textile (Cloth-of-gold cone) | PGVLDIPVKSNSDDDSIFRY(nh2) | ||
P08369 | Conorfamide-Tx2 | Conus textile (Cloth-of-gold cone) | HSGILLAWSGPRNRFVRI(nh2) | ||
P06810 | Conorfamide-Vc1 | Conus victoriae | HSGFLLAWSGPRNRFVRF(nh2) | ||
P08371 | Conorfamide-Vc1 [del1-14] | synthetic construct | FVRF(nh2) | ||
P08370 | Conorfamide-Vc1 [del1-6] | synthetic construct | AWSGPRNRFVRF(nh2) | ||
P08846 | Conorphin-T[bead] | T superfamily | Conus textile (Cloth-of-gold cone) | NCCRRQICC(nh2) | |
P06904 | Conorphin-T[del1-3,8,9] | synthetic construct | RRQI(nh2) | ||
P06906 | Conorphin-T[del1-3] | synthetic construct | RRQICC(nh2) | ||
P06905 | Conorphin-T[del8,9] | synthetic construct | NCCRRQI(nh2) | ||
P08845 | Conorphin-T[globular] | T superfamily | Conus textile (Cloth-of-gold cone) | NCCRRQICC(nh2) | |
P06910 | Conorphin-T[I7(Cha),ribbon] | synthetic construct | NCCRRQ(Cha)CC(nh2) | ||
P06912 | Conorphin-T[I7(Nal),ribbon] | synthetic construct | NCCRRQ(Nal)CC(nh2) | ||
P06901 | Conorphin-T[I7A,ribbon] | synthetic construct | NCCRRQACC(nh2) | ||
P06911 | Conorphin-T[I7F,ribbon] | synthetic construct | NCCRRQFCC(nh2) | ||
P06909 | Conorphin-T[I7L,ribbon] | synthetic construct | NCCRRQLCC(nh2) | ||
P06908 | Conorphin-T[I7V,ribbon] | synthetic construct | NCCRRQVCC(nh2) | ||
P08847 | Conorphin-T[N1(Anc),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (Anc)rrQ(Cha)CC(nh2) | ||
P06928 | Conorphin-T[N1(BrBnz),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (3BrBnz)rrQ(Cha)CC(nh2) | ||
P06924 | Conorphin-T[N1(BrBz),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (3BrBz)rrQ(Cha)CC(nh2) | ||
P08891 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,del6_Q,I7(Cha)] | synthetic construct | (BzP)rr(Cha)CC(nh2) | ||
P08869 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Dap)] | synthetic construct | ZrrQ(Cha)(Dap)(nh2) | ||
P08873 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Meg)] | synthetic construct | (BzP)rrQ(Cha)(Meg)C(nh2) | ||
P08875 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Mpc)] | synthetic construct | (BzP)rrQ(Cha)(Mpc)C(nh2) | ||
P08860 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Nmc)] | synthetic construct | (Bnz)PrrQ(Cha)(Nmc)C(nh2) | ||
P08859 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Pen)] | synthetic construct | (Bnz)PrrQ(Cha)(Pen)C(nh2) | ||
P08872 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C9(Meg)] | synthetic construct | (BzP)rrQ(Cha)C(Meg)(nh2) | ||
P08876 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C9(Mpc)] | synthetic construct | (BzP)rrQ(Cha)C(Mpc)(nh2) | ||
P08862 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),ins8_CH2NH] | synthetic construct | (BzP)rrQ(Cha)(CH3N)CC(nh2) | ||
P08871 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),insC_CH2] | synthetic construct | (BzP)rrQ(Cha)CC(CH3N)(nh2) | ||
P08880 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (BzP)rrQ(Cha)(nh2) | ||
P08853 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (Bnz)PrrQ(Cha)CC(nh2) | ||
P08863 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Chg)] | synthetic construct | (BzP)rrQ(Chg)CC(nh2) | ||
P08884 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6A,I7(Cha)] | synthetic construct | (BzP)rrA(Cha)CC(nh2) | ||
P08889 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6D,I7(Cha)] | synthetic construct | (BzP)rrD(Cha)CC(nh2) | ||
P08890 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6E,I7(Cha)] | synthetic construct | (BzP)rrE(Cha)CC(nh2) | ||
P08887 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6F,I7(Cha)] | synthetic construct | (BzP)rrF(Cha)CC(nh2) | ||
P08888 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6G,I7(Cha)] | synthetic construct | (BzP)rrG(Cha)CC(nh2) | ||
P08883 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6K,I7(Cha)] | synthetic construct | (BzP)rrK(Cha)CC(nh2) | ||
P08885 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6L,I7(Cha)] | synthetic construct | (BzP)rrL(Cha)CC(nh2) | ||
P08881 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6N,I7(Cha)] | synthetic construct | (BzP)rrN(Cha)CC(nh2) | ||
P08882 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6R,I7(Cha)] | synthetic construct | (BzP)rrR(Cha)CC(nh2) | ||
P08886 | Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6S,I7(Cha)] | synthetic construct | (BzP)rrS(Cha)CC(nh2) | ||
P06925 | Conorphin-T[N1(ClBnz),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (3ClBnz)rrQ(Cha)CC(nh2) | ||
P06926 | Conorphin-T[N1(ClBz),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (3ClBz)rrQ(Cha)CC(nh2) | ||
P08855 | Conorphin-T[N1(ClBzP),del2-3,R4r,R5r,I7(Cha),ins6_C] | synthetic construct | (ClBzP)rrQC(Cha)CC(nh2) | ||
P08852 | Conorphin-T[N1(ClBzP),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (4ClBz)rrQ(Cha)CC(nh2) | ||
P06927 | Conorphin-T[N1(FBnz),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (4FBnz)rrQ(Cha)CC(nh2) | ||
P06923 | Conorphin-T[N1(FBz),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (4FBz)rrQ(Cha)CC(nh2) | ||
P08856 | Conorphin-T[N1(HOBzP),del2-3,R4r,R5r,I7(Cha),ins6_C] | synthetic construct | (HOBzP)rrQC(Cha)CC(nh2) | ||
P08854 | Conorphin-T[N1(MeOBzP),del2-3,R4r,R5r,I7(Cha),ins6_C] | synthetic construct | (MeOBzP)rrQC(Cha)CC(nh2) | ||
P08857 | Conorphin-T[N1(NOBzP),del2-3,R4r,R5r,I7(Cha),ins6_C] | synthetic construct | (NOBzP)rrQC(Cha)CC(nh2) | ||
P08851 | Conorphin-T[N1(NzP),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (NzP)rrQ(Cha)CC(nh2) | ||
P08848 | Conorphin-T[N1(Qin),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (Qin)rrQ(Cha)CC(nh2) | ||
P08867 | Conorphin-T[N1(Tic),del2-3,R4r,R5r,I7(Cha),C8(Sec),C9(Sec)] | synthetic construct | (Tic)rrQ(Cha)(Sec)(Sec)(nh2) | ||
P08849 | Conorphin-T[N1(Tic),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (Tic)rrQ(Cha)CC(nh2) | ||
P08850 | Conorphin-T[N1(Tiq),del2-3,R4r,R5r,I7(Cha)] | synthetic construct | (Tiq)rrQ(Cha)CC(nh2) | ||
P06907 | Conorphin-T[N1U,del2,3] | synthetic construct | ZRRQICC(nh2) | ||
P06919 | Conorphin-T[N1U,del2-3,I7(Cha)] | synthetic construct | ZRRQ(Cha)CC(nh2) | ||
P08866 | Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C8(Hcy),C9(Hcy)] | synthetic construct | ZrrQ(Cha)(Hcy)(Hcy)(nh2) | ||
P08864 | Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C8(Hcy)] | synthetic construct | ZrrQ(Cha)(Hcy)C(nh2) | ||
P08858 | Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C8(Pen)] | synthetic construct | ZrrQ(Cha)(Pen)C(nh2) | ||
P08868 | Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C8(Sec)] | synthetic construct | ZrrQ(Cha)(Sec)C(nh2) | ||
P08865 | Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C9(Hcy)] | synthetic construct | ZrrQ(Cha)C(Hcy)(nh2) | ||
P06922 | Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha)] | synthetic construct | ZrrQ(Cha)CC(nh2) | ||
P06921 | Conorphin-T[N1U,del2-3,R5r,I7(Cha)] | synthetic construct | ZRrQ(Cha)CC(nh2) | ||
P06902 | Conorphin-T[N1U,ribbon] | synthetic construct | ZCCRRQICC(nh2) | ||
P06903 | Conorphin-T[N1Y,ribbon] | synthetic construct | YCCRRQICC(nh2) | ||
P08874 | Conorphin-T[N1Z,del2-3,I7(Cha),C8(Acc),del9_C] | synthetic construct | ZRRQ(Cha)(Acc)(nh2) | ||
P06900 | Conorphin-T[Q6A,ribbon] | synthetic construct | NCCRRAICC(nh2) | ||
P06917 | Conorphin-T[R4(Cit),ribbon] | synthetic construct | NCC(Cit)RQICC(nh2) | ||
P06898 | Conorphin-T[R4A,ribbon] | synthetic construct | NCCARQICC(nh2) | ||
P06913 | Conorphin-T[R4H,ribbon] | synthetic construct | NCCHRQICC(nh2) | ||
P06915 | Conorphin-T[R4K,ribbon] | synthetic construct | NCCKRQICC(nh2) | ||
P06918 | Conorphin-T[R5(Cit),ribbon] | synthetic construct | NCCR(Cit)QICC(nh2) | ||
P06899 | Conorphin-T[R5A,ribbon] | synthetic construct | NCCRAQICC(nh2) | ||
P06914 | Conorphin-T[R5H,ribbon] | synthetic construct | NCCRHQICC(nh2) | ||
P06916 | Conorphin-T[R5K,ribbon] | synthetic construct | NCCRKQICC(nh2) | ||
P06897 | Conorphin-T[ribbon] | T superfamily | Conus textile (Cloth-of-gold cone) | NCCRRQICC(nh2) | |
P09801 | Contryphan Eu1 | Conus eburneus | GCOPGLWC(nh2) | ||
P01270 | Contryphan-Am | O2 superfamily | Conus amadis | GCOwDPWC(nh2) | |
P09754 | Contryphan-Ar1 | Conus araneosus | ES(Gla)CPwHPWC(nh2) | ||
P09753 | Contryphan-Ar2 | O2 superfamily | Conus araneosus | ES(Gla)CPwKPWC(nh2) | |
P08776 | Contryphan-Be | Conus betulinus | VVGCOwQPWC(nh2) | ||
P04624 | Contryphan-Bu | O2 superfamily | Conus bullatus | KCOwSPWC(nh2) | |
P09768 | Contryphan-Eb | O2 superfamily | Conus ebraeus | GCPWHPWC(nh2) | |
P08777 | Contryphan-Fi | Conus figulinus | VVGCOwQPWC(nh2) | ||
P06828 | Contryphan-Fib | Conus figulinus | GCOWMPWC(nh2) | ||
P09757 | Contryphan-Fr1 | O2 superfamily | Conus frigidus | GCOwDPWC(nh2) | |
P09767 | Contryphan-Fr2 | O2 superfamily | Conus frigidus | GCOwDSWC(nh2) | |
P01271 | Contryphan-In | Conus inscriptus | GCVlYPWC(nh2) | ||
P10517 | Contryphan-In2 | Conus inscriptus | RCPWDPWCN(nh2) | ||
P10518 | Contryphan-In3 | Conus inscriptus | CVLYOWC(nh2) | ||
P09769 | Contryphan-Li1 | O2 superfamily | Conus lividus | GCPWNPWC(nh2) | |
P09770 | Contryphan-Li2 | O2 superfamily | Conus lividus | GCPFQPWC(nh2) | |
P01272 | Contryphan-Lo1 | Conus loroisii | GCPwDPWC(nh2) | ||
P09766 | Contryphan-Lo2 | O2 superfamily | Conus loroisii | NECPwQPWC(nh2) | |
P02621 | Contryphan-Lt1 | O2 superfamily | Conus litteratus | GCOwEPWC(nh2) | |
P09772 | Contryphan-Lt2 | O2 superfamily | Conus litteratus | GCPWYPWC(nh2) | |
P02570 | contryphan-M | O2 superfamily | Conus marmoreus | N(Gla)S(Gla)CPwHPWC(nh2) | |
P05389 | contryphan-M2 | O2 superfamily | Conus marmoreus | ESECPWHPWC(nh2) | |
P09771 | Contryphan-Mi | O2 superfamily | Conus miles | GCPWDPWC(nh2) | |
P09773 | Contryphan-Mo | Conus monile | ESECPWKPWC(nh2) | ||
P02597 | Contryphan-P | O2 superfamily | Conus purpurascens | GCOwDPWC(nh2) | |
P01372 | Contryphan-R | O2 superfamily | Conus radiatus | GCOwEP(Btr)C(nh2) | |
P01355 | Contryphan-R [Des-Gly1] | synthetic construct | COwQPWC(nh2) | ||
P03549 | Contryphan-S | O2 superfamily | Conus striatus (Striated cone) | GCOwEPWC(nh2) | |
P01318 | Contryphan-Sm | O2 superfamily | Conus stercusmuscarum | GCOwQPWC(nh2) | |
P02622 | Contryphan-Tx | O2 superfamily | Conus textile (Cloth-of-gold cone) | GCOwQPYC(nh2) | |
P04517 | Contryphan-Vi | O2 superfamily | Conus virgo | GCPWHPWC(nh2) | |
P01309 | Contryphan-Vn | Conus ventricosus | GDCPwKPWC(nh2) | ||
P07531 | Contryphan-Vn [W8S] | Conus ventricosus | GDCPwKPSC(nh2) | ||
P07557 | Contryphan-Ze | Conus zeylanicus | VVGCOwQPWC(nh2) | ||
P02548 | CVIA | O1 superfamily | Conus catus | CKSTGASCRRTSYDCCTGSCRSGRC(nh2) | |
P01726 | CVIB | O1 superfamily | Conus catus | CKGKGASCRKTMYDCCRGSCRSGRC(nh2) | |
P01725 | CVIC | O1 superfamily | Conus catus | CKGKGQSCSKLMYDCCTGSCSRRGKC(nh2) | |
P02549 | CVID | O1 superfamily | Conus catus | CKSKGAKCSKLMYDCCSGSCSGTVGRC(nh2) | |
P04324 | CVID[K10R] | synthetic construct | CKSKGAKCSRLMYDCCSGSCSGTVGRC(nh2) | ||
P05863 | CVID[K2A,K10R] | synthetic construct | CASKGAKCSRLMYDCCSGSCSGTVGRC(nh2) | ||
P04243 | CVIE | O1 superfamily | Conus catus | CKGKGASCRRTSYDCCTGSCRSGRC(nh2) | |
P08607 | CVIE[R10K] | synthetic construct | CKGKGASCRKTSYDCCTGSCRSGRC(nh2) | ||
P03340 | CVIF | Conus catus | CKGKGASCRRTSYDCCTGSCRLGRC(nh2) | ||
P08606 | CVIF[R10K] | synthetic construct | CKGKGASCRKTSYDCCTGSCRLGRC(nh2) | ||
P01262 | Cyclic contryphan | synthetic construct | GCOyNPKC(nh2) | ||
P08893 | Czon1107 | Conus zonatus (zoned cone) | GFRSPCPPFC(nh2) | ||
P08894 | Czon1107[P5A] | synthetic construct | GFRSACPPFC(nh2) | ||
P08895 | Czon1107[P7A] | synthetic construct | GFRSPCAPFC(nh2) | ||
P02550 | De13a | Conus delessertii | DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG CTH(nh2) |
||
P05522 | De13b | G superfamily | Conus delessertii | DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVRQHCSGCNH(nh2) | |
P01496 | DeVIIA | O1 superfamily | Conus delessertii | ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2) | |
P00050 | EI | A superfamily | Conus ermineus (Atlantic fish-hunting cone) | RDOCCYHPTCNMSNPQIC(nh2) | |
P09022 | EI[D2A] | synthetic construct | RAOCCYHPTCNMSNPQIC(nh2) | ||
P09036 | EI[del1-2] | synthetic construct | OCCYHPTCNMSNPQIC(nh2) | ||
P09037 | EI[del1-3] | synthetic construct | CCYHPTCNMSNPQIC(nh2) | ||
P09035 | EI[del1] | synthetic construct | DOCCYHPTCNMSNPQIC(nh2) | ||
P09025 | EI[H7A] | synthetic construct | RDOCCYAPTCNMSNPQIC(nh2) | ||
P09034 | EI[I17A] | synthetic construct | RDOCCYHPTCNMSNPQAC(nh2) | ||
P09029 | EI[M12A] | synthetic construct | RDOCCYHPTCNASNPQIC(nh2) | ||
P09028 | EI[N11A] | synthetic construct | RDOCCYHPTCAMSNPQIC(nh2) | ||
P09031 | EI[N14A] | synthetic construct | RDOCCYHPTCNMSAPQIC(nh2) | ||
P09023 | EI[O3A] | synthetic construct | RDACCYHPTCNMSNPQIC(nh2) | ||
P09032 | EI[P15A] | synthetic construct | RDOCCYHPTCNMSNAQIC(nh2) | ||
P09026 | EI[P8A] | synthetic construct | RDOCCYHATCNMSNPQIC(nh2) | ||
P09033 | EI[Q16A] | synthetic construct | RDOCCYHPTCNMSNPAIC(nh2) | ||
P09021 | EI[R1A] | synthetic construct | ADOCCYHPTCNMSNPQIC(nh2) | ||
P09030 | EI[S13A] | synthetic construct | RDOCCYHPTCNMANPQIC(nh2) | ||
P09027 | EI[T9A] | synthetic construct | RDOCCYHPACNMSNPQIC(nh2) | ||
P09024 | EI[Y6A] | synthetic construct | RDOCCAHPTCNMSNPQIC(nh2) | ||
P04069 | EIIA | A superfamily | Conus ermineus (Atlantic fish-hunting cone) | ZTOGCCWNPACVKNRC(nh2) | |
P07538 | EIIB | Conus ermineus (Atlantic fish-hunting cone) | ZTOGCCWHPACGKNRC(nh2) | ||
P01635 | EIVA | Conus ermineus (Atlantic fish-hunting cone) | GCCGPYONAACHOCGCKVGROOYCDROSGG(nh2) | ||
P01740 | EIVB | Conus ermineus (Atlantic fish-hunting cone) | GCCGKYONAACHOCGCTVGROOYCDROSGG(nh2) | ||
P02569 | Em11.10 | I2 superfamily | Conus emaciatus | CFPPGIYCTPYLPCCWGICCGTCRNVCHLRI(nh2) | |
P02577 | Ep11.12 | I2 superfamily | Conus episcopatus | CLSEGSPCSMSGSCCHKSCCRSTCTFPCLIP(nh2) | |
P00405 | EpI | A superfamily | Conus episcopatus | GCCSDPRCNMNNPD(sTy)C(nh2) | |
P00112 | EpI [sTy15Y] | synthetic construct | GCCSDPRCNMNNPDYC(nh2) | ||
P04507 | Eu1.3 | A superfamily | Conus eburneus | LIAPFIRDYCCPRGPCMVWC(nh2) | |
P04644 | Eu1.6 | A superfamily | Conus eburneus | GCCSNPACMLKNPNLC(nh2) | |
P09797 | Eu3.11 | Conus eburneus | CCQAACSPWLCLPCC(nh2) | ||
P09803 | Eu3.13 | Conus eburneus | DCCVMPWCDGACDCCVSS(nh2) | ||
P09793 | Eu5.13 | Conus eburneus | TLQRHWAKSLCCPEDAWCCSHDE(nh2) | ||
P09796 | Eu6.13 | Conus eburneus | GDEECNEYCDDRNKECCGRTNGHPRCANVCF(nh2) | ||
P01561 | EVIA | O1 superfamily | Conus ermineus (Atlantic fish-hunting cone) | DDCIKOYGFCSLPILKNGLCCSGACVGVCADL(nh2) | |
P01575 | EVIB | O1 superfamily | Conus ermineus (Atlantic fish-hunting cone) | EACYOOGTFCGIKOGLCCSELCLPAVCVG(nh2) | |
P02719 | Fe14.1 | J superfamily | Conus ferrugineus | SPGSTICKMACRTGNGHKYPFCNCR(nh2) | |
P02720 | Fe14.2 | J superfamily | Conus ferrugineus | SSGSTVCKMMCRLGYGHLYPSCGCR(nh2) | |
P02656 | Fi11.11 | I2 superfamily | Conus figulinus | CHHEGLPCTSGDGCCGMECCGGVCSSHCGN(nh2) | |
P04241 | FVIA | Conus fulmen | CKGTGKSCSRIAYNCCTGSCRSGKC(nh2) | ||
P01307 | Gamma-conopressin-vil | Conus villepinii | CLIQDCP(Gla)G(nh2) | ||
P00074 | GI | A superfamily | Conus geographus (Geography cone) | ECCNPACGRHYSC(nh2) | |
P04398 | GI [R9A] | synthetic construct | ECCNPACGAHYSC(nh2) | ||
P00408 | GI antitoxic analog | synthetic construct | CANPACGRHYS(nh2) | ||
P10468 | GI[del8, ribbon] | synthetic construct | ECCNPACRHYSC(nh2) | ||
P10462 | GI[del8] | synthetic construct | ECCNPACRHYSC(nh2) | ||
P09094 | GI[E1A] | synthetic construct | ACCNPACGRHYSC(nh2) | ||
P09097 | GI[G8A] | synthetic construct | ECCNPACARHYSC(nh2) | ||
P09099 | GI[H10A] | synthetic construct | ECCNPACGRAYSC(nh2) | ||
P10464 | GI[ins13_A] | synthetic construct | ECCNPACGRHYSAC(nh2) | ||
P10467 | GI[ins13_AK] | synthetic construct | ECCNPACGRHYSAKC(nh2) | ||
P10463 | GI[ins13_G] | synthetic construct | ECCNPACGRHYSGC(nh2) | ||
P10469 | GI[ins13_GG] | synthetic construct | ECCNPACGRHYSGGC(nh2) | ||
P10466 | GI[ins13_K] | synthetic construct | ECCNPACGRHYSKC(nh2) | ||
P10476 | GI[ins13_KA] | synthetic construct | ECCNPACGRHYSKAC(nh2) | ||
P10465 | GI[ins13_R] | synthetic construct | ECCNPACGRHYSRC(nh2) | ||
P09095 | GI[N4A] | synthetic construct | ECCAPACGRHYSC(nh2) | ||
P09096 | GI[P5A] | synthetic construct | ECCNAACGRHYSC(nh2) | ||
P09098 | GI[R9A] | synthetic construct | ECCNPACGAHYSC(nh2) | ||
P09101 | GI[S12A] | synthetic construct | ECCNPACGRHYAC(nh2) | ||
P09100 | GI[Y11A] | synthetic construct | ECCNPACGRHASC(nh2) | ||
P00132 | GIC | A superfamily | Conus geographus (Geography cone) | GCCSHPACAGNNQHIC(nh2) | |
P03557 | GID amidated [(GLA)4E] | synthetic construct | IRDECCSNPACRVNNOHVC(nh2) | ||
P00024 | GII | A superfamily | Conus geographus (Geography cone) | ECCHPACGKHFSC(nh2) | |
P01571 | GIIIA | M superfamily | Conus geographus (Geography cone) | RDCCTOOKKCKDRQCKOQRCCA(nh2) | |
P07484 | GIIIA [A10C, A21C] | M superfamily | Conus geographus (Geography cone) | RDCCTOOKKAKDRQCKOQRCAA(nh2) | |
P07486 | GIIIA [A3C,A10C,A15C,A21C] | M superfamily | Conus geographus (Geography cone) | RDACTOOKKAKDRQAKOQRCAA(nh2) | |
P07488 | GIIIA [A3C,A4C,A10C,A15C,A20C,A21C] | M superfamily | Conus geographus (Geography cone) | RDAATOOKKAKDRQAKOQRAAA(nh2) | |
P07485 | GIIIA [A3C,A4C,A15C,A20C] | M superfamily | Conus geographus (Geography cone) | RDAATOOKKCKDRQAKOQRACA(nh2) | |
P07482 | GIIIA [A3C] | M superfamily | Conus geographus (Geography cone) | RDACTOOKKCKDRQAKOQRCCA(nh2) | |
P07487 | GIIIA [A4C,A10C,A20C,A21C] | M superfamily | Conus geographus (Geography cone) | RDCATOOKKAKDRQCKOQRAAA(nh2) | |
P07483 | GIIIA [A4C,C20A] | M superfamily | Conus geographus (Geography cone) | RDCATOOKKCKDRQCKOQRACA(nh2) | |
P01570 | GIIIA [R13A] | synthetic construct | RDCCTOOKKCKDAQCKOQRCCA(nh2) | ||
P01566 | GIIIB | M superfamily | Conus geographus (Geography cone) | RDCCTOORKCKDRRCKOMKCCA(nh2) | |
P01744 | GIIIC | Conus geographus (Geography cone) | RDCCTOOKKCKDRRCKOLKCCA(nh2) | ||
P02845 | Gla(2)-TxVI/A | O2 superfamily | Conus textile (Cloth-of-gold cone) | SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2) | |
P02846 | Gla(2)-TxVI/B | O2 superfamily | Conus textile (Cloth-of-gold cone) | NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2) | |
P02692 | Gla-MrIII | T superfamily | Conus marmoreus | FCCRTQ(Gla)VCC(Gla)AIKN(nh2) | |
P04397 | Gly-AnIB | synthetic construct | GGGCCSHPACAANNQD(sTy)C(nh2) | ||
P02574 | Gm5.2 | T superfamily | Conus gloriamaris | VCCRPVQDCCS(nh2) | |
P02576 | GmIXA | P superfamily | Conus gloriamaris | SCNNSCQSHSDCASHCICTFRGCGAVN(nh2) | |
P01546 | GVIA | O1 superfamily | Conus geographus (Geography cone) | CKSOGSSCSOTSYNCCRSCNOYTKRCY(nh2) | |
P01780 | GVIA [O10>K] | synthetic construct | CKSOGSSCSKTSYNCCRSCNOYTKRCY(nh2) | ||
P05701 | GVIA[C8U,C19U] | synthetic construct | CKSOGSSUSOTSYNCCRSUNOYTKRCY(nh2) | ||
P02582 | GVIIIA | S superfamily | Conus geographus (Geography cone) | GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG CACS(nh2) |
|
P08941 | GVIIIB | S superfamily | Conus geographus (Geography cone) | SGSTCTCFTSTNCQGSCECLSPPGCYCSNNGIRQRGCSCTC PGT(nh2) |
|
P10491 | Ile-SII(3-14)-NH2 | synthetic construct | ICCNPACGPNYGC(nh2) | ||
P04646 | Im1.8 | A superfamily | Conus imperialis | LIAPFIRDYCCPRGPCMVWC(nh2) | |
P02584 | Im5.1 | T superfamily | Conus imperialis | SCCGKNPGCCPW(nh2) | |
P00010 | ImI | A superfamily | Conus imperialis | GCCSDPRCAWRC(nh2) | |
P04412 | ImI [A9S] | synthetic construct | GCCSDPRCAWRC(nh2) | ||
P03636 | ImI [C2Agl,C8Agl] | synthetic construct | G(Agl)CSDPR(Agl)AWRC(nh2) | ||
P08438 | ImI [C2H,C8F] | synthetic construct | GHCSDPRFAWRC(nh2) | ||
P02479 | ImI [C2U,C3U,C8U,C12U] | synthetic construct | GUUSDPRUAWRU(nh2) | ||
P02478 | ImI [C2U,C8U] | synthetic construct | GUCSDPRUAWRC(nh2) | ||
P04417 | ImI [C3U,C12U] | synthetic construct | GCUSDPRCAWRU(nh2) | ||
P04469 | ImI [D5A] | synthetic construct | GCCSAPRCAWRC(nh2) | ||
P04405 | ImI [D5E] | synthetic construct | GCCSEPRCAWRC(nh2) | ||
P04406 | ImI [D5K] | synthetic construct | GCCSKPRCAWRC(nh2) | ||
P00035 | ImI [D5N] | synthetic construct | GCCSNPRCAWRC(nh2) | ||
P04416 | ImI [D5R,R7D] | synthetic construct | GCCSRPDCAWRC(nh2) | ||
P04468 | ImI [G1A] | synthetic construct | ACCSDPRCAWRC(nh2) | ||
P04418 | ImI [P60] | synthetic construct | GCCSDORCAWRC(nh2) | ||
P04420 | ImI [P6A(S)Pro] | synthetic construct | GCCSD(A(S)Pro)RCAWRC(nh2) | ||
P02852 | ImI [P6A] | synthetic construct | GCCSDARCAWRC(nh2) | ||
P04419 | ImI [P6APro] | synthetic construct | GCCSD(APro)RCAWRC(nh2) | ||
P04427 | ImI [P6benzPro] | synthetic construct | GCCSD(benz-Pro)RCAWRC(nh2) | ||
P04422 | ImI [P6betPro] | synthetic construct | GCCSD(bet-Pro)RCAWRC(nh2) | ||
P04424 | ImI [P6fluo(S)Pro] | synthetic construct | GCCSD(F-(S)-Pro)RCAWRC(nh2) | ||
P04423 | ImI [P6fluoPro] | synthetic construct | GCCSD(F-Pro)RCAWRC(nh2) | ||
P04407 | ImI [P6G] | synthetic construct | GCCSDGRCAWRC(nh2) | ||
P04421 | ImI [P6guaPro] | synthetic construct | GCCSD(Gua-Pro)RCAWRC(nh2) | ||
P02851 | ImI [P6K] | synthetic construct | GCCSDKRCAWRC(nh2) | ||
P04428 | ImI [P6naphPro] | synthetic construct | GCCSD(naph-Prot)RCAWRC(nh2) | ||
P04429 | ImI [P6phi(3S)Pro] | synthetic construct | GCCSD(phi3-Pro)RCAWRC(nh2) | ||
P04430 | ImI [P6phi(5R)Pro] | synthetic construct | GCCSD(phi5-Pro)RCAWRC(nh2) | ||
P04426 | ImI [P6phi(S)Pro] | synthetic construct | GCCSD(phi-(S)-Pro)RCAWRC(nh2) | ||
P04425 | ImI [P6phiPro] | synthetic construct | GCCSD(phi-Pro)RCAWRC(nh2) | ||
P04473 | ImI [P6S] | synthetic construct | GCCSDSRCAWRC(nh2) | ||
P04408 | ImI [P6V] | synthetic construct | GCCSDVRCAWRC(nh2) | ||
P04472 | ImI [R11A] | synthetic construct | GCCSDPRCAWAC(nh2) | ||
P00033 | ImI [R11E] | synthetic construct | GCCSDPRCAWEC(nh2) | ||
P04415 | ImI [R11Q] | synthetic construct | GCCSDPRCAWQC(nh2) | ||
P04470 | ImI [R7A] | synthetic construct | GCCSDPACAWRC(nh2) | ||
P04411 | ImI [R7E] | synthetic construct | GCCSDPECAWRC(nh2) | ||
P04410 | ImI [R7K] | synthetic construct | GCCSDPKCAWRC(nh2) | ||
P00034 | ImI [R7L] | synthetic construct | GCCSDPLCAWRC(nh2) | ||
P04475 | ImI [R7Nle] | synthetic construct | GCCSDP(Nle)CAWRC(nh2) | ||
P04409 | ImI [R7Q] | synthetic construct | GCCSDPQCAWRC(nh2) | ||
P04403 | ImI [S4A] | synthetic construct | GCCADPRCAWRC(nh2) | ||
P04471 | ImI [W10A] | synthetic construct | GCCSDPRCAARC(nh2) | ||
P04413 | ImI [W10F] | synthetic construct | GCCSDPRCAFRC(nh2) | ||
P04414 | ImI [W10T] | synthetic construct | GCCSDPRCATRC(nh2) | ||
P04474 | ImI [W10Y] | synthetic construct | GCCSDPRCAYRC(nh2) | ||
P06677 | Imi1 | synthetic construct | G(L-Dtn)ASDPRCAWRC(nh2) | ||
P02586 | ImII | A superfamily | Conus imperialis | ACCSDRRCRWRC(nh2) | |
P03894 | ImII [W10Y] | synthetic construct | ACCSDRRCRYRC(nh2) | ||
P03893 | ImII-iso | synthetic construct | ACCSDRRCRWRC(nh2) | ||
P02617 | ImIIA | A superfamily | Conus imperialis | YCCHRGPCMVWC(nh2) | |
P10519 | In1.1 | Conus inscriptus | EGCCSNPOCRHNHOEVC(nh2) | ||
P10520 | In1.2 | Conus inscriptus | ZGCCSNPOCRHNHPEVC(nh2) | ||
P10521 | In1.3 | Conus inscriptus | GCCSHPOCNVNNPHICG(nh2) | ||
P10522 | In3.2 | Conus inscriptus | CCEWOCHHGCIPCCY(nh2) | ||
P02587 | KIIIA | M superfamily | Conus kinoshitai | CCNCSSKWCRDHSRCC(nh2) | |
P04490 | KIIIA [D11A] | synthetic construct | CCNCSSKWCRAHSRCC(nh2) | ||
P04309 | KIIIA [H12A] | synthetic construct | CCNCSSKWCRDASRCC(nh2) | ||
P04307 | KIIIA [K7A] | synthetic construct | CCNCSSAWCRDHSRCC(nh2) | ||
P04485 | KIIIA [K7NLeu] | synthetic construct | CCNCSS(Nle)WCRDHSRCC(nh2) | ||
P04482 | KIIIA [N3A] | synthetic construct | CCACSSKWCRDHSRCC(nh2) | ||
P04308 | KIIIA [R10A] | synthetic construct | CCNCSSKWCADHSRCC(nh2) | ||
P04489 | KIIIA [R10A] | synthetic construct | CCNCSSKWCADHSRCC(nh2) | ||
P04306 | KIIIA [R14A] | synthetic construct | CCNCSSKWCRDHSACC(nh2) | ||
P04491 | KIIIA [S13A] | synthetic construct | CCNCSSKWCRDHARCC(nh2) | ||
P04483 | KIIIA [S5A] | synthetic construct | CCNCASKWCRDHSRCC(nh2) | ||
P04484 | KIIIA [S6A] | synthetic construct | CCNCSAKWCRDHSRCC(nh2) | ||
P04486 | KIIIA [W8A] | synthetic construct | CCNCSSKACRDHSRCC(nh2) | ||
P04488 | KIIIA [W8dTrp] | synthetic construct | CCNCSSKwCRDHSRCC(nh2) | ||
P04323 | KIIIA [W8E] | synthetic construct | CCNCSSKECRDHSRCC(nh2) | ||
P04487 | KIIIA [W8L] | synthetic construct | CCNCSSKLCRDHSRCC(nh2) | ||
P04322 | KIIIA [W8Q] | synthetic construct | CCNCSSKQCRDHSRCC(nh2) | ||
P04321 | KIIIA [W8R] | synthetic construct | CCNCSSKRCRDHSRCC(nh2) | ||
P07433 | KIIIA-P2 | synthetic construct | CCNCSSKWCRDHSRCC(nh2) | ||
P03578 | KIIIA[C1A,C9A] | synthetic construct | ACNCSSKWARDHSRCC(nh2) | ||
P03579 | KIIIA[C2A,C15A] | synthetic construct | CANCSSKWCRDHSRAC(nh2) | ||
P03580 | KIIIA[C4A,C16A] | synthetic construct | CCNASSKWCRDHSRCA(nh2) | ||
P03581 | KIIIA[Del1,S3/S4Aop,C9A] | synthetic construct | CNC(Aop)KWARDHARCC(nh2) | ||
P07434 | KIIIB | Conus kinoshitai | NGCCNCSSKWCRDHSRCC(nh2) | ||
P07435 | KIIIB-P1 | synthetic construct | NGCCNCSSKWCRDHSRCC(nh2) | ||
P02659 | Leu-contryphan-Tx | O2 superfamily | Conus textile (Cloth-of-gold cone) | CVlYPWC(nh2) | |
P05283 | Li1.12 | Conus lividus | GCCSHPVCSAMSPIC(nh2) | ||
P02578 | LiC32 | T superfamily | Conus lividus | LWQNTWCCRDHLRCC(nh2) | |
P02579 | LiC33 | T superfamily | Conus lividus | ALCCYGYRFCCPIF(nh2) | |
P08784 | Lo6.1 | Conus longurionis | DQCSYCGIYCCPPKFCTSAGCRSP(nh2) | ||
P08783 | Lo6.2 | Conus longurionis | SCLSSGALCGIDSNCCNGCNVPRNQCY(nh2) | ||
P02496 | Lp1.1 | A superfamily | Conus leopardus | GCCARAACAGIHQELC(nh2) | |
P02505 | Lp1.10 | A superfamily | Conus leopardus | NDCCHNAPCRNNHPGIC(nh2) | |
P02660 | Lp1.2 | A superfamily | Conus leopardus | GCCSHPACSVNNPYFCG(nh2) | |
P02497 | Lp1.4 | A superfamily | Conus leopardus | GCCSHPACSGNHQELCD(nh2) | |
P02498 | Lp1.5 | A superfamily | Conus leopardus | DCCDDPACTVNNPGLCT(nh2) | |
P02499 | Lp1.6a | A superfamily | Conus leopardus | QFCCGHYDCDFIPNVC(nh2) | |
P06776 | LsIA | Conus limpusi | SGCCSNPACRVNNPNIC(nh2) | ||
P06779 | LsIA [del1-2] | synthetic construct | CCSNPACRVNNPNIC(nh2) | ||
P06778 | LsIA [del1] | synthetic construct | GCCSNPACRVNNPNIC(nh2) | ||
P08948 | LsIA [N12D] | synthetic construct | SGCCSNPACRVDNPNIC(nh2) | ||
P08949 | LsIA [N12L] | synthetic construct | SGCCSNPACRVLNPNIC(nh2) | ||
P08947 | LsIA [N12Q] | synthetic construct | SGCCSNPACRVQNPNIC(nh2) | ||
P08943 | LsIA [N6H] | synthetic construct | SGCCSHPACRVNNPNIC(nh2) | ||
P08945 | LsIA [R10D] | synthetic construct | SGCCSNPACDVNNPNIC(nh2) | ||
P08950 | LsIA [R10F,N12L] | synthetic construct | SGCCSNPACFVLNPNIC(nh2) | ||
P08946 | LsIA [R10F] | synthetic construct | SGCCSNPACDVNNPNIC(nh2) | ||
P08944 | LsIA [R10M] | synthetic construct | SGCCSNPACMVNNPNIC(nh2) | ||
P10431 | LsIA[insA5, ribbon] | synthetic construct | SGCCASNPACRVNNPNIC(nh2) | ||
P10432 | LsIA[insA5] | synthetic construct | SGCCASNPACRVNNPNIC(nh2) | ||
P10435 | LsIA[insR6, ribbon] | synthetic construct | SGCCSRNPACRVNNPNIC(nh2) | ||
P10436 | LsIA[insR6] | synthetic construct | SGCCSRNPACRVNNPNIC(nh2) | ||
P10430 | LsIA[ribbon] | synthetic construct | SGCCSNPACRVNNPNIC(nh2) | ||
P10434 | LsIA[S5R, ribbon] | synthetic construct | SGCCRNPACRVNNPNIC(nh2) | ||
P10433 | LsIA[S5R] | synthetic construct | SGCCRNPACRVNNPNIC(nh2) | ||
P02666 | Lt1.2 | A superfamily | Conus litteratus | GCCARAACAGIHQELCG(nh2) | |
P07494 | Lt1.3 [F15A] | synthetic construct | GCCSHPACSGNNPYAC(nh2) | ||
P07480 | Lt1.3 [globular] | Conus litteratus | GCCSHPACSGNNPYFC(nh2) | ||
P07490 | Lt1.3 [N11A] | synthetic construct | GCCSHPACSGANPYFC(nh2) | ||
P07491 | Lt1.3 [N12A] | synthetic construct | GCCSHPACSGNAPYFC(nh2) | ||
P07492 | Lt1.3 [P13A] | synthetic construct | GCCSHPACSGNNAYFC(nh2) | ||
P07495 | Lt1.3 [ribbon] | Conus litteratus | GCCSHPACSGNNPYFC(nh2) | ||
P07489 | Lt1.3 [S9A] | synthetic construct | GCCSHPACAGNNPYFC(nh2) | ||
P07493 | Lt1.3 [Y14A] | synthetic construct | GCCSHPACSGNNPAFC(nh2) | ||
P02632 | Lt5.1 | T superfamily | Conus litteratus | ECCEDGWCCTAAPLT(nh2) | |
P02633 | Lt5.2 | T superfamily | Conus litteratus | PCCSIHDNSCC(nh2) | |
P02665 | LtIA | A superfamily | Conus litteratus | GCCARAACAGIHQELC(nh2) | |
P04479 | LtIA [A4S,A6P] | synthetic construct | GCCSRPACAGIHQELC(nh2) | ||
P04478 | LtIA [A4S] | synthetic construct | GCCSRAACAGIHQELC(nh2) | ||
P10394 | LtIA-F | synthetic construct | (5-TAMRA)GCCARAACAGIHQELC(nh2) | ||
P02588 | LtXIVA | L superfamily | Conus litteratus | MCPPLCKPSCTNC(nh2) | |
P04259 | LtXIVA [K7A] | synthetic construct | MCPPLCAPSCTNC(nh2) | ||
P06424 | Lv1d | A superfamily | Conus lividus | GCCSDPPCRHKHQDLC(nh2) | |
P05949 | LvIA | Conus lividus | GCCSHPACNVDHPEIC(nh2) | ||
P09963 | LvIA[D11A] | synthetic construct | GCCSHPACNVAHPEIC(nh2) | ||
P09964 | LvIA[E14A] | synthetic construct | GCCSHPACNVDHPAIC(nh2) | ||
P09957 | LvIA[G1A] | synthetic construct | ACCSHPACNVDHPEIC(nh2) | ||
P09970 | LvIA[H12A] | synthetic construct | GCCSHPACNVDAPEIC(nh2) | ||
P09959 | LvIA[H5A] | synthetic construct | GCCSAPACNVDHPEIC(nh2) | ||
P09965 | LvIA[I15A] | synthetic construct | GCCSHPACNVDHPEAC(nh2) | ||
P09961 | LvIA[N9A] | synthetic construct | GCCSHPACAVDHPEIC(nh2) | ||
P09972 | LvIA[N9D] | synthetic construct | GCCSHPACDVDHPEIC(nh2) | ||
P09966 | LvIA[N9G] | synthetic construct | GCCSHPACGVDHPEIC(nh2) | ||
P09969 | LvIA[N9I] | synthetic construct | GCCSHPACIVDHPEIC(nh2) | ||
P09968 | LvIA[N9K] | synthetic construct | GCCSHPACKVDHPEIC(nh2) | ||
P09967 | LvIA[N9L] | synthetic construct | GCCSHPACLVDHPEIC(nh2) | ||
P09971 | LvIA[P13A] | synthetic construct | GCCSHPACNVDHAEIC(nh2) | ||
P09960 | LvIA[P6A] | synthetic construct | GCCSHAACNVDHPEIC(nh2) | ||
P09958 | LvIA[S4A] | synthetic construct | GCCAHPACNVDHPEIC(nh2) | ||
P09962 | LvIA[V10A] | synthetic construct | GCCSHPACNADHPEIC(nh2) | ||
P10271 | LvIB[del1,14] | synthetic construct | CCSNPPCAHEHC(nh2) | ||
P10270 | LvIB[del14] | synthetic construct | QCCSNPPCAHEHC(nh2) | ||
P10269 | LvIB[Q1G,del14] | synthetic construct | GCCSNPPCAHEHC(nh2) | ||
P10736 | LvIC | Conus lividus | DCCANPVCNGKHCQ(nh2) | ||
P00014 | M1A | A superfamily | Conus magus (Magus cone) | DGRCCHPACAKHFNC(nh2) | |
P00016 | M1B | A superfamily | Conus magus (Magus cone) | NGRCCHPACARKYNC(nh2) | |
P02676 | MaI51 | O2 superfamily | Conus marmoreus | QCEDVWMPCTSNWECCSLDCEMYCTQI(nh2) | |
P00023 | MI | A superfamily | Conus magus (Magus cone) | GRCCHPACGKNYSC(nh2) | |
P04455 | MI [H5A] | synthetic construct | GRCCAPACGKNYSC(nh2) | ||
P04457 | MI [K10A] | synthetic construct | GRCCHPACGANYSC(nh2) | ||
P04458 | MI [N11A] | synthetic construct | GRCCHPACGKAYSC(nh2) | ||
P04456 | MI [P6A] | synthetic construct | GRCCHAACGKNYSC(nh2) | ||
P04454 | MI [R2A] | synthetic construct | GACCHPACGKNYSC(nh2) | ||
P04463 | MI [S13A] | synthetic construct | GRCCHPACGKNYAC(nh2) | ||
P04459 | MI [Y12A] | synthetic construct | GRCCHPACGKNASC(nh2) | ||
P04465 | MI [Y12Dit] | synthetic construct | GRCCHPACGKN(Dit)SC(nh2) | ||
P04461 | MI [Y12H] | synthetic construct | GRCCHPACGKNHSC(nh2) | ||
P04460 | MI [Y12M] | synthetic construct | GRCCHPACGKNMSC(nh2) | ||
P04462 | MI [Y12W] | synthetic construct | GRCCHPACGKNWSC(nh2) | ||
P02593 | Mi5.2 | T superfamily | Conus miles | CCPGNFACC(nh2) | |
P05866 | MI[del1] | synthetic construct | RCCHPACGKNYSC(nh2) | ||
P10470 | MI[del9] | synthetic construct | GRCCHPACKNYSC(nh2) | ||
P10471 | MI[ins14_A] | synthetic construct | GRCCHPACGKNYSAC(nh2) | ||
P10473 | MI[ins14_K] | synthetic construct | GRCCHPACGKNYSKC(nh2) | ||
P10474 | MI[ins14_KA] | synthetic construct | GRCCHPACGKNYSKAC(nh2) | ||
P10472 | MI[ins14_R] | synthetic construct | GRCCHPACGKNYSRC(nh2) | ||
P10475 | MI[ins14_RA] | synthetic construct | GRCCHPACGKNYSRAC(nh2) | ||
P05865 | MIC | Conus magus (Magus cone) | CCHPACGKNYSC(nh2) | ||
P00039 | MII | A superfamily | Conus magus (Magus cone) | GCCSNPVCHLEHSNLC(nh2) | |
P04392 | MII [E11A,L15A] | synthetic construct | GCCSNPVCHLAHSNAC(nh2) | ||
P03892 | MII [E11A] | synthetic construct | GCCSNPVCHLAHSNLC(nh2) | ||
P04319 | MII [E11R] | synthetic construct | GCCSNPVCHLRHSNLC(nh2) | ||
P04476 | MII [G1A] | synthetic construct | ACCSNPVCHLEHSNLC(nh2) | ||
P04386 | MII [H12A] | synthetic construct | GCCSNPVCHLEASNLC(nh2) | ||
P04390 | MII [H9A,L15A] | synthetic construct | GCCSNPVCALEHSNAC(nh2) | ||
P04379 | MII [H9A] | synthetic construct | GCCSNPVCALEHSNLC(nh2) | ||
P04391 | MII [L10A,L15A] | synthetic construct | GCCSNPVCHAEHSNAC(nh2) | ||
P04385 | MII [L10A] | synthetic construct | GCCSNPVCHAEHSNLC(nh2) | ||
P04380 | MII [L15A] | synthetic construct | GCCSNPVCHLEHSNAC(nh2) | ||
P04388 | MII [N14A] | synthetic construct | GCCSNPVCHLEHSALC(nh2) | ||
P04382 | MII [N5A] | synthetic construct | GCCSAPVCHLEHSNLC(nh2) | ||
P05527 | MII [N5R,E11A,H12K] | synthetic construct | GCCSRPVCHLAKSNLC(nh2) | ||
P04383 | MII [P6A] | synthetic construct | GCCSNAVCHLEHSNLC(nh2) | ||
P04387 | MII [S13A] | synthetic construct | GCCSNPVCHLEHANLC(nh2) | ||
P04477 | MII [S4A,E11A,L15A] | synthetic construct | GCCANPVCHLAHSNAC(nh2) | ||
P04389 | MII [S4A,H9A] | synthetic construct | GCCANPVCALEHSNLC(nh2) | ||
P04381 | MII [S4A] | synthetic construct | GCCANPVCHLEHSNLC(nh2) | ||
P04384 | MII [V7A] | synthetic construct | GCCSNPACHLEHSNLC(nh2) | ||
P01691 | MIIIA | Conus magus (Magus cone) | ZGCCNVPNGCSGRWCRDHAQCC(nh2) | ||
P09015 | MilIA | Conus milneedwardsi | DMCCHPACMNHFNC(nh2) | ||
P09019 | MilIA[del1,M2R,M9G,N10K,H11K] | synthetic construct | RCCHPACGKKFNC(nh2) | ||
P09018 | MilIA[del1,M2R] | synthetic construct | RCCHPACMNHFNC(nh2) | ||
P09016 | MilIA[M9G,N10K] | synthetic construct | DMCCHPACGKHFNC(nh2) | ||
P09020 | MilIA[M9G] | synthetic construct | DMCCHPACGNHFNC(nh2) | ||
P09017 | MilIA[N10K] | synthetic construct | DMCCHPACMKHFNC(nh2) | ||
P02527 | MIVA | A superfamily | Conus magus (Magus cone) | AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS COOKRKO(nh2) |
|
P06806 | Ml6.5 | O1 superfamily | Conus miliaris | CIATDDFCGLPGIGWNCCTGVCIIVCV(nh2) | |
P03638 | Mn1.4 | Conus monachus | GRCCHPACAKYFSC(nh2) | ||
P05409 | Mr026 | I2 superfamily | Conus marmoreus | LCDSYISSELCEHPEETCLLPQSYVLSVESIQTGSVYVLGS VPHISKTS(nh2) |
|
P05511 | Mr038 | M superfamily | Conus marmoreus | N(Gla)FLTHTFS(Btr)HPTWCPWC(nh2) | |
P02491 | Mr1.1 | A superfamily | Conus marmoreus | GCCSHPACSVNNPDIC(nh2) | |
P02493 | Mr1.2 | A superfamily | Conus marmoreus | GCCSNPPCYANNQAYCN(nh2) | |
P02494 | Mr1.3 | A superfamily | Conus marmoreus | GCCSHPACRVHYPHVCY(nh2) | |
P04661 | Mr1.7 | A superfamily | Conus marmoreus | PECCTHPACHVSHPELC(nh2) | |
P09093 | Mr1.7[del1,E2G,V11G,S12N] | synthetic construct | GCCTHPACHGNHPELC(nh2) | ||
P09091 | Mr1.7[E2A,S12N] | synthetic construct | PACCTHPACHVNHPELC(nh2) | ||
P09085 | Mr1.7[E2A] | synthetic construct | PACCTHPACHVSHPELC(nh2) | ||
P09086 | Mr1.7[H10A] | synthetic construct | PECCTHPACAVSHPELC(nh2) | ||
P09087 | Mr1.7[H13A] | synthetic construct | PECCTHPACHVSAPELC(nh2) | ||
P09090 | Mr1.7[H13N] | synthetic construct | PECCTHPACHVSNPELC(nh2) | ||
P09083 | Mr1.7[insN_R] | synthetic construct | RPECCTHPACHVSHPELC(nh2) | ||
P09084 | Mr1.7[P1A] | synthetic construct | AECCTHPACHVSHPELC(nh2) | ||
P09089 | Mr1.7[S12N] | synthetic construct | PECCTHPACHVNHPELC(nh2) | ||
P09092 | Mr1.7[V11G,S12N] | synthetic construct | PECCTHPACHGNHPELC(nh2) | ||
P09088 | Mr1.7[V11G] | synthetic construct | PECCTHPACHGSHPELC(nh2) | ||
P06002 | Mr1.8a | A superfamily | Conus marmoreus | ECCTHPACHVSNPELC(nh2) | |
P05431 | Mr1.9 | M superfamily | Conus marmoreus | VCCPFGGCHELCTADD(nh2) | |
P05411 | Mr14.6 | I2 superfamily | Conus marmoreus | LCDSYISS(Gla)LC(Gla)HP(Gla)ETCLLPQSYVLSVE SIQTGSVYVLEACRIFTKTS(nh2) |
|
P05416 | Mr3.11 | M superfamily | Conus marmoreus | CCRIACNLKCNOCC(nh2) | |
P05422 | Mr3.12 | M superfamily | Conus marmoreus | LCCWKEWCHARCTCC(nh2) | |
P05424 | Mr3.13 | M superfamily | Conus marmoreus | LCCWIHWCHARCTCC(nh2) | |
P05433 | Mr3.16 | M superfamily | Conus marmoreus | VCCSFGSCDSLCQCCD(nh2) | |
P02688 | Mr3.5 | M superfamily | Conus marmoreus | MGCCPFPCKTSCTTLCC(nh2) | |
P05378 | Mr6.12 | O2 superfamily | Conus marmoreus | GCKATWMSCSSGWECCSMSCDMYC(nh2) | |
P05373 | Mr6.28 | O2 superfamily | Conus marmoreus | QCEDVWMPCTSNWECCSLDCERYCTQI(nh2) | |
P07576 | MrIA [insN_(Hfe)] | synthetic construct | (HFE)NGVCCGYKLCHOC(nh2) | ||
P08712 | MrIA [insN_ILRGILR,del 6-13] | synthetic construct | ILRGILRNGVCC(nh2) | ||
P07575 | MrIA [insN_W] | synthetic construct | WNGVCCGYKLCHOC(nh2) | ||
P07571 | MrIA [N1(Abz)] | synthetic construct | (ABZ)GVCCGYKLCHOC(nh2) | ||
P07560 | MrIA [N1(Bhk)] | synthetic construct | (BHK)GVCCGYKLCHOC(nh2) | ||
P07568 | MrIA [N1(Cit)] | synthetic construct | (Cit)GVCCGYKLCHOC(nh2) | ||
P07574 | MrIA [N1(Dmf)] | synthetic construct | (DMF)GVCCGYKLCHOC(nh2) | ||
P07563 | MrIA [N1(Nle)] | synthetic construct | (Nle)GVCCGYKLCHOC(nh2) | ||
P07565 | MrIA [N1A] | synthetic construct | AGVCCGYKLCHOC(nh2) | ||
P07570 | MrIA [N1D] | synthetic construct | DGVCCGYKLCHOC(nh2) | ||
P07567 | MrIA [N1F] | synthetic construct | FGVCCGYKLCHOC(nh2) | ||
P07564 | MrIA [N1G] | synthetic construct | GGVCCGYKLCHOC(nh2) | ||
P07566 | MrIA [N1I] | synthetic construct | IGVCCGYKLCHOC(nh2) | ||
P07561 | MrIA [N1k] | synthetic construct | kGVCCGYKLCHOC(nh2) | ||
P07572 | MrIA [N1n] | synthetic construct | nGVCCGYKLCHOC(nh2) | ||
P07569 | MrIA [N1Q] | synthetic construct | QGVCCGYKLCHOC(nh2) | ||
P07559 | MrIA [N1r] | synthetic construct | rGVCCGYKLCHOC(nh2) | ||
P07558 | MrIA [N1R] | synthetic construct | RGVCCGYKLCHOC(nh2) | ||
P07562 | MrIA [N1S] | synthetic construct | SGVCCGYKLCHOC(nh2) | ||
P07573 | MrIA [N1T] | synthetic construct | TGVCCGYKLCHOC(nh2) | ||
P07635 | MrIA [N1Z, C10c] | synthetic construct | ZGVCCGYKLcHOC(nh2) | ||
P07637 | MrIA [N1Z, C13c] | synthetic construct | ZGVCCGYKLCHOc(nh2) | ||
P07639 | MrIA [N1Z, C4(Hcy), C5(Hcy), C10(Hcy), C13(Hcy)] | synthetic construct | ZGV(Hcy)(Hcy)GYKL(Hcy)HO(Hcy)(nh2) | ||
P07636 | MrIA [N1Z, C4c, C13c] | synthetic construct | ZGVcCGYKLCHOc(nh2) | ||
P07633 | MrIA [N1Z, C4c, C5c, C10c, C13c] | synthetic construct | ZGVccGYKLcHOc(nh2) | ||
P07638 | MrIA [N1Z, C4c] | synthetic construct | ZGVcCGYKLCHOC(nh2) | ||
P07634 | MrIA [N1Z, C5c, C10c] | synthetic construct | ZGVCcGYKLcHOC(nh2) | ||
P07640 | MrIA [N1Z, Y7(Mty), H11W] | synthetic construct | ZGVCCG(Mty)KLCWOC(nh2) | ||
P07641 | MrIA [N1Z, Y7(Mty), L9(Cha), H11W] | synthetic construct | ZGVCCG(Mty)K(Cha)CWOC(nh2) | ||
P07621 | MrIA [N1Z,H11(Bta)] | synthetic construct | ZGVCCGYKLC(BTA)OC(nh2) | ||
P07616 | MrIA [N1Z,H11(Fla)] | synthetic construct | ZGVCCGYKLC(FLA)OC(nh2) | ||
P07620 | MrIA [N1Z,H11(Nal)] | synthetic construct | ZGVCCGYKLC(Nal)OC(nh2) | ||
P07617 | MrIA [N1Z,H11(Pya)] | synthetic construct | ZGVCCGYKLC(PYA)OC(nh2) | ||
P07625 | MrIA [N1Z,H11E] | synthetic construct | ZGVCCGYKLCEOC(nh2) | ||
P07615 | MrIA [N1Z,H11F] | synthetic construct | ZGVCCGYKLCFOC(nh2) | ||
P07622 | MrIA [N1Z,H11h] | synthetic construct | ZGVCCGYKLChOC(nh2) | ||
P07624 | MrIA [N1Z,H11L] | synthetic construct | ZGVCCGYKLCLOC(nh2) | ||
P07623 | MrIA [N1Z,H11P] | synthetic construct | ZGVCCGYKLCPOC(nh2) | ||
P07626 | MrIA [N1Z,H11Q] | synthetic construct | ZGVCCGYKLCQOC(nh2) | ||
P07614 | MrIA [N1Z,H11R] | synthetic construct | ZGVCCGYKLCROC(nh2) | ||
P07619 | MrIA [N1Z,H11W] | synthetic construct | ZGVCCGYKLCWOC(nh2) | ||
P07618 | MrIA [N1Z,H11Y] | synthetic construct | ZGVCCGYKLCYOC(nh2) | ||
P07603 | MrIA [N1Z,K8(Cit)] | synthetic construct | ZGVCCGY(Cit)LCHOC(nh2) | ||
P07596 | MrIA [N1Z,K8(Hly)] | synthetic construct | ZGVCCGY(HLY)LCHOC(nh2) | ||
P07602 | MrIA [N1Z,K8(Nle)] | synthetic construct | ZGVCCGY(Nle)LCHOC(nh2) | ||
P07595 | MrIA [N1Z,K8(Orn)] | synthetic construct | ZGVCCGY(Orn)LCHOC(nh2) | ||
P07601 | MrIA [N1Z,K8E] | synthetic construct | ZGVCCGYELCHOC(nh2) | ||
P07600 | MrIA [N1Z,K8I] | synthetic construct | ZGVCCGYILCHOC(nh2) | ||
P07594 | MrIA [N1Z,K8k] | synthetic construct | ZGVCCGYkLCHOC(nh2) | ||
P07599 | MrIA [N1Z,K8L] | synthetic construct | ZGVCCGYLLCHOC(nh2) | ||
P07598 | MrIA [N1Z,K8Q] | synthetic construct | ZGVCCGYQLCHOC(nh2) | ||
P07597 | MrIA [N1Z,K8R] | synthetic construct | ZGVCCGYRLCHOC(nh2) | ||
P07604 | MrIA [N1Z,K8W] | synthetic construct | ZGVCCGYWLCHOC(nh2) | ||
P07608 | MrIA [N1Z,L9(Cha)] | synthetic construct | ZGVCCGYK(Chg)CHOC(nh2) | ||
P07607 | MrIA [N1Z,L9(Hle)] | synthetic construct | ZGVCCGYK(HLE)CHOC(nh2) | ||
P07606 | MrIA [N1Z,L9(Nle)] | synthetic construct | ZGVCCGYK(Nle)CHOC(nh2) | ||
P07610 | MrIA [N1Z,L9I] | synthetic construct | ZGVCCGYKICHOC(nh2) | ||
P07611 | MrIA [N1Z,L9P] | synthetic construct | ZGVCCGYKPCHOC(nh2) | ||
P07609 | MrIA [N1Z,L9Q] | synthetic construct | ZGVCCGYKQCHOC(nh2) | ||
P07612 | MrIA [N1Z,L9R] | synthetic construct | ZGVCCGYKRCHOC(nh2) | ||
P07613 | MrIA [N1Z,L9S] | synthetic construct | ZGVCCGYKSCHOC(nh2) | ||
P07605 | MrIA [N1Z,L9V] | synthetic construct | ZGVCCGYKVCHOC(nh2) | ||
P07630 | MrIA [N1Z,O12(Mey)] | synthetic construct | ZGVCCGYKLCH(Mty)C(nh2) | ||
P07628 | MrIA [N1Z,O12(Tic)] | synthetic construct | ZGVCCGYKLCH(Tic)C(nh2) | ||
P07631 | MrIA [N1Z,O12D] | synthetic construct | ZGVCCGYKLCHDC(nh2) | ||
P07632 | MrIA [N1Z,O12E] | synthetic construct | ZGVCCGYKLCHEC(nh2) | ||
P07627 | MrIA [N1Z,O12K] | synthetic construct | ZGVCCGYKLCHKC(nh2) | ||
P07629 | MrIA [N1Z,O12Y] | synthetic construct | ZGVCCGYKLCHYC(nh2) | ||
P07582 | MrIA [N1Z,Y7(Cha)] | synthetic construct | ZGVCCG(Cha)KLCHOC(nh2) | ||
P07577 | MrIA [N1Z,Y7(Dmk)] | synthetic construct | ZGVCCG(DMF)KLCHOC(nh2) | ||
P07578 | MrIA [N1Z,Y7(Dpa)] | synthetic construct | ZGVCCG(DPA)KLCHOC(nh2) | ||
P07579 | MrIA [N1Z,Y7(Hly)] | synthetic construct | ZGVCCG(HLY)KLCHOC(nh2) | ||
P07581 | MrIA [N1Z,Y7(Mty)] | synthetic construct | ZGVCCG(Mty)KLCHOC(nh2) | ||
P07593 | MrIA [N1Z,Y7(Thi)] | synthetic construct | ZGVCCG(THI)KLCHOC(nh2) | ||
P07584 | MrIA [N1Z,Y7E] | synthetic construct | ZGVCCGEKLCHOC(nh2) | ||
P07580 | MrIA [N1Z,Y7F] | synthetic construct | ZGVCCGFKLCHOC(nh2) | ||
P07585 | MrIA [N1Z,Y7I] | synthetic construct | ZGVCCGIKLCHOC(nh2) | ||
P07586 | MrIA [N1Z,Y7K] | synthetic construct | ZGVCCGKKLCHOC(nh2) | ||
P07587 | MrIA [N1Z,Y7L] | synthetic construct | ZGVCCGLKLCHOC(nh2) | ||
P07588 | MrIA [N1Z,Y7P] | synthetic construct | ZGVCCGPKLCHOC(nh2) | ||
P07589 | MrIA [N1Z,Y7Q] | synthetic construct | ZGVCCGQKLCHOC(nh2) | ||
P07590 | MrIA [N1Z,Y7R] | synthetic construct | ZGVCCGRKLCHOC(nh2) | ||
P07591 | MrIA [N1Z,Y7S] | synthetic construct | ZGVCCGSKLCHOC(nh2) | ||
P07583 | MrIA [N1Z,Y7W] | synthetic construct | ZGVCCGWKLCHOC(nh2) | ||
P07592 | MrIA [N1Z,Y7y] | synthetic construct | ZGVCCGyKLCHOC(nh2) | ||
P06932 | MrIA [N1Z] | synthetic construct | ZGVCCGYKLCHOC(nh2) | ||
P04492 | MrIA amidated | synthetic construct | NGVCCGYKLCHOC(nh2) | ||
P08710 | MrIA amidated [N1Z,del10-13] | synthetic construct | ZGVCCGYKL(nh2) | ||
P08774 | MrIA amidated [O12P] | synthetic construct | NGVCCGYKLCHPC(nh2) | ||
P02849 | MrIB amidated | synthetic construct | VGVCCGYKLCHOC(nh2) | ||
P06003 | MrIC | A superfamily | Conus marmoreus | PECCTHPACHVSNPELC(nh2) | |
P02696 | MrIIID | M superfamily | Conus marmoreus | CCRLSCGLGCHOCC(nh2) | |
P02697 | MrIIIE | M superfamily | Conus marmoreus | VCCPFGGCHELCYCCD(nh2) | |
P01485 | MrIIIF | M superfamily | Conus marmoreus | VCCPFGGCHELCLCCD(nh2) | |
P02698 | MrIIIG | M superfamily | Conus marmoreus | DCCOLPACPFGCNOCC(nh2) | |
P01624 | MVIA | O1 superfamily | Conus magus (Magus cone) | DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2) | |
P01623 | MVIB | O1 superfamily | Conus magus (Magus cone) | EACYNAGSFCGIHOGLCCSEFCILWCITFVDS(nh2) | |
P01386 | MVIIA | O1 superfamily | Conus magus (Magus cone) | CKGKGAKCSRLMYDCCTGSCRSGKC(nh2) | |
P06889 | MVIIA[D14N] | synthetic construct | CKGKGAKCSRLMYNCCTGSCRSGKC(nh2) | ||
P06887 | MVIIA[G2A,K3A,A5K,K6P] | synthetic construct | CKAAGKPCSRLMYDCCTGSCRSGKC(nh2) | ||
P04240 | MVIIA[K2A] | synthetic construct | CAGKGAKCSRLMYDCCTGSCRSGKC(nh2) | ||
P06888 | MVIIA[L11I,M12A,D14N] | synthetic construct | CKGKGAKCSRIAYNCCTGSCRSGKC(nh2) | ||
P06891 | MVIIA[L11I] | synthetic construct | CKGKGAKCSRIMYDCCTGSCRSGKC(nh2) | ||
P06890 | MVIIA[M12A] | synthetic construct | CKGKGAKCSRLAYDCCTGSCRSGKC | ||
P01661 | MVIIA[R10K] | synthetic construct | CKGKGAKCSKLMYDCCTGSCRSGKC(nh2) | ||
P04239 | MVIIA[Y13A] | synthetic construct | CKGKGAKCSRLMADCCTGSCRSGKC(nh2) | ||
P01638 | MVIIB | O1 superfamily | Conus magus (Magus cone) | CKGKGASCHRTSYDCCTGSCNRGKC(nh2) | |
P01484 | MVIIC | Conus magus (Magus cone) | CKGKGAPCRKTMYDCCSGSCGRRGKC(nh2) | ||
P01658 | MVIIC analog | synthetic construct | CKGKGAPCRKTMYDCCKGRCGRRGRC(nh2) | ||
P02675 | MVIID | O1 superfamily | Conus magus (Magus cone) | CQGRGASCRKTMYNCCSGSCNRGRC(nh2) | |
P01397 | OIVA | A superfamily | Conus obscurus | CCGVONAACHOCVCKNTC(nh2) | |
P04446 | OIVA [H10P] | synthetic construct | CCGVONAACPOCVCKNTC(nh2) | ||
P04447 | OIVA [K15N] | synthetic construct | CCGVONAACHOCVCNNTC(nh2) | ||
P01688 | OIVB | A superfamily | Conus obscurus | CCGVONAACPOCVCNKTCG(nh2) | |
P00006 | OmIA | A superfamily | Conus omaria | GCCSHPACNVNNPHICG(nh2) | |
P10486 | OmIA[H5R] | synthetic construct | GCCSRPACNVNNPHICG(nh2) | ||
P10489 | OmIA[N11D] | synthetic construct | GCCSHPACNVDNPHICG(nh2) | ||
P10487 | OmIA[N9H] | synthetic construct | GCCSHPACHVNNPHICG(nh2) | ||
P10488 | OmIA[V10Q] | synthetic construct | GCCSHPACNQNNPHICG(nh2) | ||
P04061 | P21a | Conus purpurascens | FELLPSQDRSCCIQKTLECLENYOGQASQRAHYCQQDATTN CODTYYFGCCPGYATCMSINAGNNVRSAFDKCINRLCFDPG H(nh2) |
||
P04680 | P3.9 | M superfamily | Conus purpurascens | HPPCCMYGRCRRYPGCSSASCCQ(nh2) | |
P05219 | Pc16a | Conus pictus | SCSCKRNFLCC(nh2) | ||
P05862 | Pc16c | Conus pictus | SCSCQKHFSCCD(nh2) | ||
P02608 | PeIA | A superfamily | Conus pergrandis | GCCSHPACSVNHPELC(nh2) | |
P09949 | PeIA[A7V, S9H, N11R] | synthetic construct | GCCSHPVCHVRHPELC(nh2) | ||
P09950 | PeIA[A7V, S9N, N11R, L15I] | synthetic construct | GCCSHPVCNVRHPEIC(nh2) | ||
P09951 | PeIA[A7V, S9N, N11R] | synthetic construct | GCCSHPVCNVRHPELC(nh2) | ||
P09952 | PeIA[A7V, S9R, V10A, N11R, E14A] | synthetic construct | GCCSHPVCRARHPALC(nh2) | ||
P09953 | PeIA[A7V, S9R, V10A, N11R, P13R, E14A] | synthetic construct | GCCSHPVCRARHRALC(nh2) | ||
P06804 | PeIA[A7V,S9H,V10A,N11R,E14A] | synthetic construct | GCCSHPVCHARHPALC(nh2) | ||
P06802 | PeIA[A7V,S9H,V10A,N11R] | synthetic construct | GCCSHPVCHARHPELC(nh2) | ||
P06793 | PeIA[A7V] | synthetic construct | GCCSHPVCSVNHPELC(nh2) | ||
P08993 | PeIA[E14(Aad)] | synthetic construct | GCCSHPACSVNHP(Aad)LC(nh2) | ||
P08973 | PeIA[E14(Asu)] | synthetic construct | GCCSHPACSVNHP(Asu)LC(nh2) | ||
P08972 | PeIA[E14(Gla)] | synthetic construct | GCCSHPACSVNHP(Gla)LC(nh2) | ||
P06790 | PeIA[E14A] | synthetic construct | GCCSHPACSVNHPALC(nh2) | ||
P08974 | PeIA[E14D] | synthetic construct | GCCSHPACSVNHPDLC(nh2) | ||
P05854 | PeIA[E14N] | synthetic construct | GCCSHPACSVNHPNLC(nh2) | ||
P08975 | PeIA[E14Q] | synthetic construct | GCCSHPACSVNHPQLC(nh2) | ||
P08976 | PeIA[E14R] | synthetic construct | GCCSHPACSVNHPRLC(nh2) | ||
P06787 | PeIA[H12A] | synthetic construct | GCCSHPACSVNAPELC(nh2) | ||
P06782 | PeIA[H5A] | synthetic construct | GCCSAPACSVNHPELC(nh2) | ||
P06792 | PeIA[H5N] | synthetic construct | GCCSNPACSVNHPELC(nh2) | ||
P08979 | PeIA[L15(Nle)] | synthetic construct | GCCSHPACSVNHPE(Nle)C(nh2) | ||
P06791 | PeIA[L15A] | synthetic construct | GCCSHPACSVNHPEAC(nh2) | ||
P08978 | PeIA[L15I] | synthetic construct | GCCSHPACSVNHPEIC(nh2) | ||
P08977 | PeIA[L15R] | synthetic construct | GCCSHPACSVNHPERC(nh2) | ||
P08980 | PeIA[L15V] | synthetic construct | GCCSHPACSVNHPEVC(nh2) | ||
P08969 | PeIA[N11(Aad)] | synthetic construct | GCCSHPACSV(Aad)HPELC(nh2) | ||
P08970 | PeIA[N11(Api)] | synthetic construct | GCCSHPACSV(Api)HPELC(nh2) | ||
P08971 | PeIA[N11(Asu)] | synthetic construct | GCCSHPACSV(Asu)HPELC(nh2) | ||
P06786 | PeIA[N11A] | synthetic construct | GCCSHPACSVAHPELC(nh2) | ||
P08968 | PeIA[N11D] | synthetic construct | GCCSHPACSVDHPELC(nh2) | ||
P06797 | PeIA[N11E] | synthetic construct | GCCSHPACSVEHPELC(nh2) | ||
P06799 | PeIA[N11K] | synthetic construct | GCCSHPACSVKHPELC(nh2) | ||
P06798 | PeIA[N11R] | synthetic construct | GCCSHPACSVRHPELC(nh2) | ||
P06788 | PeIA[P13A] | synthetic construct | GCCSHPACSVNHAELC(nh2) | ||
P06789 | PeIA[P13O] | synthetic construct | GCCSHPACSVNHOELC(nh2) | ||
P08410 | PeIA[P13Q] | synthetic construct | GCCSHPACSVNHQELC(nh2) | ||
P08411 | PeIA[P13R] | synthetic construct | GCCSHPACSVNHRELC(nh2) | ||
P06800 | PeIA[P13S] | synthetic construct | GCCSHPACSVNHSELC(nh2) | ||
P06783 | PeIA[P6A] | synthetic construct | GCCSHAACSVNHPELC(nh2) | ||
P06784 | PeIA[P6O] | synthetic construct | GCCSHOACSVNHPELC(nh2) | ||
P06781 | PeIA[S4A] | synthetic construct | GCCAHPACSVNHPELC(nh2) | ||
P06785 | PeIA[S9A] | synthetic construct | GCCSHPACAVNHPELC(nh2) | ||
P09044 | PeIA[S9D] | synthetic construct | GCCSHPACDVNHPELC(nh2) | ||
P08989 | PeIA[S9H,V10(Nle),N11(Api),L15I] | synthetic construct | GCCSHPACH(Nle)(Api)HPEIC(nh2) | ||
P08986 | PeIA[S9H,V10(Nle),N11(Api)] | synthetic construct | GCCSHPACH(Nle)(Api)HPELC(nh2) | ||
P06803 | PeIA[S9H,V10A,N11R,E14A] | synthetic construct | GCCSHPACHARHPALC(nh2) | ||
P06801 | PeIA[S9H,V10A,N11R] | synthetic construct | GCCSHPACHARHPELC(nh2) | ||
P09045 | PeIA[S9H,V10I,N11(Api),L15(Nle)] | synthetic construct | GCCSHPACHI(Api)HPE(Nle)C(nh2) | ||
P08987 | PeIA[S9H,V10L,L15I] | synthetic construct | GCCSHPACHLNHPEIC(nh2) | ||
P08984 | PeIA[S9H,V10L,N11(Aad)] | synthetic construct | GCCSHPACHL(Aad)HPELC(nh2) | ||
P08988 | PeIA[S9H,V10L,N11(Api),L15I] | synthetic construct | GCCSHPACHL(Api)HPEIC(nh2) | ||
P08990 | PeIA[S9H,V10L,N11(Api)] | synthetic construct | GCCSHPACHL(Api)HPELC(nh2) | ||
P08985 | PeIA[S9H,V10L,N11(Asu)] | synthetic construct | GCCSHPACHL(Asu)HPELC(nh2) | ||
P08982 | PeIA[S9H,V10L,N11D] | synthetic construct | GCCSHPACHLDHPELC(nh2) | ||
P08983 | PeIA[S9H,V10L,N11E] | synthetic construct | GCCSHPACHLEHPELC(nh2) | ||
P08981 | PeIA[S9H,V10L] | synthetic construct | GCCSHPACHLNHPELC(nh2) | ||
P05852 | PeIA[S9H] | synthetic construct | GCCSHPACHVNHPELC(nh2) | ||
P08962 | PeIA[S9N] | synthetic construct | GCCSHPACNVNHPELC(nh2) | ||
P09046 | PeIA[S9R,V10I,N11(Api),L15(Nle)] | synthetic construct | GCCSHPACRI(Api)HPE(Nle)C(nh2) | ||
P06794 | PeIA[S9R] | synthetic construct | GCCSHPACRVNHPELC(nh2) | ||
P08964 | PeIA[S9T] | synthetic construct | GCCSHPACTVNHPELC(nh2) | ||
P08963 | PeIA[S9Y] | synthetic construct | GCCSHPACYVNHPELC(nh2) | ||
P08966 | PeIA[V10(Nle)] | synthetic construct | GCCSHPACS(Nle)NHPELC(nh2) | ||
P05853 | PeIA[V10A] | synthetic construct | GCCSHPACSANHPELC(nh2) | ||
P09948 | PeIA[V10D] | synthetic construct | GCCSHPACSDNHPELC(nh2) | ||
P08965 | PeIA[V10I] | synthetic construct | GCCSHPACSINHPELC(nh2) | ||
P06796 | PeIA[V10L] | synthetic construct | GCCSHPACSLNHPELC(nh2) | ||
P06795 | PeIA[V10R] | synthetic construct | GCCSHPACSRNHPELC(nh2) | ||
P08967 | PeIA[V10T] | synthetic construct | GCCSHPACSTNHPELC(nh2) | ||
P00595 | PIA | A superfamily | Conus purpurascens | RDPCCSNPVCTVHNPQIC(nh2) | |
P04310 | PIA Δ1 | synthetic construct | DPCCSNPVCTVHNPQIC(nh2) | ||
P04311 | PIA Δ1-2 | synthetic construct | PCCSNPVCTVHNPQIC(nh2) | ||
P04312 | PIA Δ1-3 | synthetic construct | CCSNPVCTVHNPQIC(nh2) | ||
P04313 | PIA [R1ADMA] | synthetic construct | (ADMA)DPCCSNPVCTVHNPQIC(nh2) | ||
P04316 | PIA [R1E] | synthetic construct | EDPCCSNPVCTVHNPQIC(nh2) | ||
P04314 | PIA [R1K] | synthetic construct | KDPCCSNPVCTVHNPQIC(nh2) | ||
P04315 | PIA [R1L] | synthetic construct | LDPCCSNPVCTVHNPQIC(nh2) | ||
P00038 | PIB | A superfamily | Conus purpurascens | ZSOGCCWNPACVKNRC(nh2) | |
P02228 | PIIIA | M superfamily | Conus purpurascens | ZRLCCGFOKSCRSRQCKOHRCC(nh2) | |
P04296 | PIIIA [G6K] | synthetic construct | ZRLCCKFOKSCRSRQCKOHRCC(nh2) | ||
P04300 | PIIIA [K17A] | synthetic construct | ZRLCCAFOKSCRSRQCAOHRCC(nh2) | ||
P04301 | PIIIA [K17Q] | synthetic construct | ZRLCCAFOKSCRSRQCQOHRCC(nh2) | ||
P04294 | PIIIA [K17R] | synthetic construct | ZRLCCGFOKSCRSRQCROHRCC(nh2) | ||
P04297 | PIIIA [R12A] | synthetic construct | ZRLCCAFOKSCASRQCKOHRCC(nh2) | ||
P04293 | PIIIA [R12K] | synthetic construct | ZRLCCGFOKSCKSRQCKOHRCC(nh2) | ||
P04298 | PIIIA [R12Q] | synthetic construct | ZRLCCAFOKSCQSRQCKOHRCC(nh2) | ||
P04290 | PIIIA [R14A] | synthetic construct | ZRLCCGFOKSCRSAQCKOHRCC(nh2) | ||
P04292 | PIIIA [R14K] | synthetic construct | ZRLCCGFOKSCRSKQCKOHRCC(nh2) | ||
P04291 | PIIIA [R14Q] | synthetic construct | ZRLCCGFOKSCRSQQCKOHRCC(nh2) | ||
P04302 | PIIIA [R20A] | synthetic construct | ZRLCCAFOKSCRSRQCKOHACC(nh2) | ||
P04295 | PIIIA [R2A] | synthetic construct | ZALCCGFOKSCRSRQCKOHRCC(nh2) | ||
P04299 | PIIIA [S13D] | synthetic construct | ZRLCCAFOKSCRDRQCKOHRCC(nh2) | ||
P01611 | PIIIE | M superfamily | Conus purpurascens | HOOCCLYGKCRRYOGCSSASCCQR(nh2) | |
P04448 | PIIIE [K9S] | synthetic construct | HOOCCLYGKCRRYOGCSSASCCQR(nh2) | ||
P04449 | PIIIE [R12O,Y13F] | synthetic construct | HOOCCLYGKCROFOGCSSASCCQR(nh2) | ||
P04450 | PIIIE [S17Y,S18N,S20L] | synthetic construct | HOOCCLYGKCRRYOGCSSASCCQR(nh2) | ||
P01594 | PIIIF | M superfamily | Conus purpurascens | GOOCCLYGSCROFOGCYNALCCRK(nh2) | |
P04452 | PIIIF [O12R,F13Y] | synthetic construct | GOOCCLYGSCRRYOGCYNALCCRK(nh2) | ||
P04451 | PIIIF [S9K] | synthetic construct | GOOCCLYGSCROFOGCYNALCCRK(nh2) | ||
P04453 | PIIIF [Y17S,N18S,L20S] | synthetic construct | GOOCCLYGSCROFOGCSSASCCRK(nh2) | ||
P01449 | PIVA | A superfamily | Conus purpurascens | GCCGSYONAACHOCSCKDROSYCGQ(nh2) | |
P01612 | PIVA [Hyp7P,Hyp13P] | synthetic construct | GCCGSYPNAACHPCSCKDROSYCGQ(nh2) | ||
P01670 | PIVE | Conus purpurascens | DCCGVKLEMCHPCLCDNSCKNYGK(nh2) | ||
P01669 | PIVF | Conus purpurascens | DCCGVKLEMCHPCLCDNSCKKSGK(nh2) | ||
P02605 | Pl14.1 | J superfamily | Conus planorbis | GPGSAICNMACRLGQGHMYPFCNCN(nh2) | |
P02606 | Pl14.2 | J superfamily | Conus planorbis | GPGSAICNMACRLEHGHLYPFCHCR(nh2) | |
P02607 | Pl14.3 | J superfamily | Conus planorbis | GPGSAICNMACRLEHGHLYPFCNCD(nh2) | |
P01539 | PlXIVA | J superfamily | Conus planorbis | FPRPRICNLACRAGIGHKYPFCHCR(nh2) | |
P02700 | Pn-0111 | T superfamily | Conus pennaceus | MCCLGTSGCCPW(nh2) | |
P02701 | Pn-014 | T superfamily | Conus pennaceus | YDCCKTFECCHW(nh2) | |
P02702 | Pn-B01121 | T superfamily | Conus pennaceus | YCCVYDYSCCLSW(nh2) | |
P02704 | Pn-B01411 | T superfamily | Conus pennaceus | CCYETPGCCVI(nh2) | |
P02706 | Pn-B02 | T superfamily | Conus pennaceus | ECCSDGWCCPA(nh2) | |
P00075 | Pni1 | synthetic construct | GCCSLPPCAANNPDYC(nh2) | ||
P00051 | PnIA | A superfamily | Conus pennaceus | GCCSLPPCAANNPD(sTy)C(nh2) | |
P00505 | PnIA [A10L,D14K,sTy15Y] | synthetic construct | GCCSLPPCALNNPKYC(nh2) | ||
P04375 | PnIA [A10L,sTy15Y] | synthetic construct | GCCSLPPCALNNPDYC(nh2) | ||
P07528 | PnIA [A9R,A10L] | synthetic construct | GCCSLPPCRLNNPDYC(nh2) | ||
P07527 | PnIA [A9R] | synthetic construct | GCCSLPPCRANNPDYC(nh2) | ||
P04444 | PnIA [L5R,A10L,sTy15Y] | synthetic construct | GCCSRPPCALNNPDYC(nh2) | ||
P07529 | PnIA [L5R,A9R,A10L,D14R] | synthetic construct | GCCSRPPCRLNNPRYC(nh2) | ||
P04376 | PnIA [N11S,sTy15Y] | synthetic construct | GCCSLPPCAASNPDYC(nh2) | ||
P04433 | PnIA [P6A(S)Pro] | synthetic construct | GCCSL(A(S)Pro)PCAANNPD(sTy)C(nh2) | ||
P04432 | PnIA [P6APro] | synthetic construct | GCCSL(APro)PCAANNPD(sTy)C(nh2) | ||
P04440 | PnIA [P6benzPro] | synthetic construct | GCCSL(benz-Pro)PCAANNPD(sTy)C(nh2) | ||
P04435 | PnIA [P6betPro] | synthetic construct | GCCSL(bet-Pro)PCAANNPD(sTy)C(nh2) | ||
P04437 | PnIA [P6fluo(S)Pro] | synthetic construct | GCCSL(F-(S)-Pro)PCAANNPD(sTy)C(nh2) | ||
P04436 | PnIA [P6fluoPro] | synthetic construct | GCCSL(F-Pro)PCAANNPD(sTy)C(nh2) | ||
P04434 | PnIA [P6guaPro] | synthetic construct | GCCSL(Gua-Pro)PCAANNPD(sTy)C(nh2) | ||
P04441 | PnIA [P6naphPro] | synthetic construct | GCCSL(naph-Prot)PCAANNPD(sTy)C(nh2) | ||
P04431 | PnIA [P6O] | synthetic construct | GCCSLOPCAANNPD(sTy)C(nh2) | ||
P04442 | PnIA [P6phi(3S)Pro] | synthetic construct | GCCSL(phi3-Pro)PCAANNPD(sTy)C(nh2) | ||
P04443 | PnIA [P6phi(5R)Pro] | synthetic construct | GCCSL(phi5-Pro)PCAANNPD(sTy)C(nh2) | ||
P04439 | PnIA [P6phi(S)Pro] | synthetic construct | GCCSL(phi-(S)-Pro)PCAANNPD(sTy)C(nh2) | ||
P04438 | PnIA [P6phiPro] | synthetic construct | GCCSL(phi-Pro)PCAANNPD(sTy)C(nh2) | ||
P04377 | PnIA [sTy15Y] | synthetic construct | GCCSLPPCAANNPDYC(nh2) | ||
P10272 | PnIA[A10L] | synthetic construct | GCCSLPPCALNNPDYC(nh2) | ||
P00099 | PnIB | A superfamily | Conus pennaceus | GCCSLPPCALSNPD(sTy)C(nh2) | |
P04378 | PnIB [sTy15Y] | synthetic construct | GCCSLPPCALSNPDYC(nh2) | ||
P04211 | Pr3b | Conus parius | ERVCCGYOMSCKSRACKOSYCC(nh2) | ||
P02832 | PrIIIE | M superfamily | Conus parius | AARCCTYHGSCLKEKCRRKYCC(nh2) | |
P02859 | PrXA | C superfamily | Conus parius | TYGIYDAKPOFSCAGLRGGCVLPONLROKFKE(nh2) | |
P02519 | Pu1.1 | A superfamily | Conus pulicarius | QNCCNVPGCWAKYKHLC(nh2) | |
P02520 | Pu1.2 | A superfamily | Conus pulicarius | GGCCSYPPCIANNPLC(nh2) | |
P07436 | Pu1.2[C3S,C9S] | synthetic construct | GGSCSYPPSIANNPLC(nh2) | ||
P07438 | Pu1.2[del1-8] | synthetic construct | CIANNPLC(nh2) | ||
P07437 | Pu1.2[del10-16,C4S] | synthetic construct | GGCSSYPPC(nh2) | ||
P02790 | Pu5.1 | T superfamily | Conus pulicarius | SCCPSPTSCCPW(nh2) | |
P02792 | Pu5.2 | T superfamily | Conus pulicarius | GCCEDKTCCFI(nh2) | |
P02796 | Pu5.4 | T superfamily | Conus pulicarius | SCCPEEITCCPW(nh2) | |
P02596 | PVA | T superfamily | Conus purpurascens | GCCPKQMRCCTL(nh2) | |
P02595 | PVIA | O1 superfamily | Conus purpurascens | EACYAOGTFCGIKOGLCCSEFCLPGVCFG(nh2) | |
P01356 | PVIIA | O1 superfamily | Conus purpurascens | CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | |
P04364 | PVIIA [D13A] | synthetic construct | CRIONQKCFQHLADCCSRKCNRFNKCV(nh2) | ||
P04369 | PVIIA [F23A] | synthetic construct | CRIONQKCFQHLDDCCSRKCNRANKCV(nh2) | ||
P04359 | PVIIA [F9A] | synthetic construct | CRIONQKCAQHLDDCCSRKCNRFNKCV(nh2) | ||
P04360 | PVIIA [F9M] | synthetic construct | CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04361 | PVIIA [F9Y] | synthetic construct | CRIONQKCYQHLDDCCSRKCNRFNKCV(nh2) | ||
P04363 | PVIIA [H11A] | synthetic construct | CRIONQKCFQALDDCCSRKCNRFNKCV(nh2) | ||
P04355 | PVIIA [I3A] | synthetic construct | CRAONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04367 | PVIIA [K19A] | synthetic construct | CRIONQKCFQHLDDCCSRACNRFNKCV(nh2) | ||
P04371 | PVIIA [K25A] | synthetic construct | CRIONQKCFQHLDDCCSRKCNRFNACV(nh2) | ||
P04357 | PVIIA [K7A] | synthetic construct | CRIONQACFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04358 | PVIIA [K7R] | synthetic construct | CRIONQRCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04370 | PVIIA [N24A] | synthetic construct | CRIONQKCFQHLDDCCSRKCNRFAKCV(nh2) | ||
P04362 | PVIIA [Q10A] | synthetic construct | CRIONQKCFAHLDDCCSRKCNRFNKCV(nh2) | ||
P04356 | PVIIA [Q6A] | synthetic construct | CRIONAKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04366 | PVIIA [R18A] | synthetic construct | CRIONQKCFQHLDDCCSAKCNRFNKCV(nh2) | ||
P04368 | PVIIA [R22A] | synthetic construct | CRIONQKCFQHLDDCCSRKCNAFNKCV(nh2) | ||
P04352 | PVIIA [R2A] | synthetic construct | CAIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04354 | PVIIA [R2K] | synthetic construct | CKIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04353 | PVIIA [R2Q] | synthetic construct | CQIONQKCFQHLDDCCSRKCNRFNKCV(nh2) | ||
P04365 | PVIIA [S17A] | synthetic construct | CRIONQKCFQHLDDCCARKCNRFNKCV(nh2) | ||
P02511 | Qc1.2 | A superfamily | Conus quercinus | QCCANPPCKHVNC(nh2) | |
P02513 | Qc1.4 | A superfamily | Conus quercinus | QGCCSDPACAVSNPDIC(nh2) | |
P02514 | Qc1.4a | A superfamily | Conus quercinus | DGCCSNPSCSVNNPDIC(nh2) | |
P02515 | Qc1.4b | A superfamily | Conus quercinus | DGCCPNPSCSVNNPDIC(nh2) | |
P02516 | Qc1.5 | A superfamily | Conus quercinus | GCCSNPACSVNHPELC(nh2) | |
P02517 | Qc1.6 | A superfamily | Conus quercinus | GCCSNPTCAGNNGNIC(nh2) | |
P01514 | QcIIIA | M superfamily | Conus quercinus | CCSQDCLVCIOCCPN(nh2) | |
P01513 | QcIIIB | M superfamily | Conus quercinus | CCSRHCWVCIOCCPN(nh2) | |
P10477 | QuIA | synthetic construct | DECCSNPSCAQTHPEIC(nh2) | ||
P04317 | RDP-MII | synthetic construct | RDPGCCSNPVCHLEHSNLC(nh2) | ||
P04320 | RDP-MII [E11R] | synthetic construct | RDPGCCSNPVCHLRHSNLC(nh2) | ||
P04318 | RDP-MII [R1ADMA] | synthetic construct | (ADMA)DPGCCSNPVCHLEHSNLC(nh2) | ||
P01493 | Reg12e | M superfamily | Conus regius | KCCMRPICTCOCCIGP(nh2) | |
P00028 | Reg1b/Reg1c | A superfamily | Conus regius | GCCSDORCKHQC(nh2) | |
P00029 | Reg1d | A superfamily | Conus regius | GCCSDPRCKHEC(nh2) | |
P00031 | Reg1f | A superfamily | Conus regius | DYCCRROOCTLIC(nh2) | |
P08536 | reg3f | M superfamily | Conus regius | GCCPFPACTTHIICRCC(nh2) | |
P08560 | reg3g | Conus regius | CCMALCSRYHCLPCC(nh2) | ||
P08538 | reg3h | Conus regius | GCCSOWNCIQLRACOCCON(nh2) | ||
P08534 | reg3k | M superfamily | Conus regius | KCCMRPICMCOCCIGP(nh2) | |
P00032 | RegIIA | A superfamily | Conus regius | GCCSHPACNVNNPHIC(nh2) | |
P09055 | RegIIA[H14A] | synthetic construct | GCCSHPACNVNNPAIC(nh2) | ||
P10483 | RegIIA[H14D] | synthetic construct | GCCSHPACNVNNPDIC(nh2) | ||
P10484 | RegIIA[H14N] | synthetic construct | GCCSHPACNVNNPNIC(nh2) | ||
P10482 | RegIIA[H14S] | synthetic construct | GCCSHPACNVNNPSIC(nh2) | ||
P10485 | RegIIA[H14W] | synthetic construct | GCCSHPACNVNNPWIC(nh2) | ||
P10481 | RegIIA[H14Y] | synthetic construct | GCCSHPACNVNNPYIC(nh2) | ||
P08487 | RegIIA[H5D] | synthetic construct | GCCSDPACNVNNPHIC(nh2) | ||
P09056 | RegIIA[I15A] | synthetic construct | GCCSHPACNVNNPHAC(nh2) | ||
P09057 | RegIIA[N11A,N12A] | synthetic construct | GCCSHPACNVAAPHIC(nh2) | ||
P09052 | RegIIA[N11A] | synthetic construct | GCCSHPACNVANPHIC(nh2) | ||
P09176 | RegIIA[N11H] | synthetic construct | GCCSHPACNVHNPHIC(nh2) | ||
P09177 | RegIIA[N11R] | synthetic construct | GCCSHPACNVRNPHIC(nh2) | ||
P09178 | RegIIA[N11Y] | synthetic construct | GCCSHPACNVYNPHIC(nh2) | ||
P09053 | RegIIA[N12A] | synthetic construct | GCCSHPACNVNAPHIC(nh2) | ||
P09050 | RegIIA[N9A] | synthetic construct | GCCSHPACAVNNPHIC(nh2) | ||
P09170 | RegIIA[N9F] | synthetic construct | GCCSHPACFVNNPHIC(nh2) | ||
P09173 | RegIIA[N9R] | synthetic construct | GCCSHPACRVNNPHIC(nh2) | ||
P09171 | RegIIA[N9W] | synthetic construct | GCCSHPACWVNNPHIC(nh2) | ||
P09172 | RegIIA[N9Y] | synthetic construct | GCCSHPACYVNNPHIC(nh2) | ||
P09054 | RegIIA[P13A] | synthetic construct | GCCSHPACNVNNAHIC(nh2) | ||
P09051 | RegIIA[V10A] | synthetic construct | GCCSHPACNANNPHIC(nh2) | ||
P09174 | RegIIA[V10F] | synthetic construct | GCCSHPACNFNNPHIC(nh2) | ||
P09175 | RegIIA[V10Y] | synthetic construct | GCCSHPACNYNNPHIC(nh2) | ||
P07466 | RgIA [del13] | synthetic construct | GCCSDPRCRYRC(nh2) | ||
P00030 | RgIA [P6O,del13] | A superfamily | Conus regius | GCCSDORCRYRC(nh2) | |
P09747 | RgIA [R13COOH-Phe] amidated | synthetic construct | GCCSDPRCRYRC(COOH-Phe)(nh2) | ||
P09745 | RgIA [R13F] amidated | synthetic construct | GCCSDPRCRYRCF(nh2) | ||
P09746 | RgIA [R13Y] amidated | synthetic construct | GCCSDPRCRYRCR(nh2) | ||
P07656 | RgIA [R7r,R9r,R11r,del13] amidated | synthetic construct | GCCSDPrCrYrC(nh2) | ||
P02591 | RIIIK | M superfamily | Conus radiatus | LOSCCSLNLRLCOVOACKRNOCCT(nh2) | |
P04337 | RIIIK [K18A] | synthetic construct | LOSCCSLNLRLCOVOACARNOCCT(nh2) | ||
P04339 | RIIIK [K18R, R19K] | synthetic construct | LOSCCSLNLRLCOVOACRKNOCCT(nh2) | ||
P04333 | RIIIK [L11A] | synthetic construct | LOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04325 | RIIIK [L1A] | synthetic construct | AOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04344 | RIIIK [L1E] | synthetic construct | EOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04350 | RIIIK [L1F] | synthetic construct | FOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04345 | RIIIK [L1H] | synthetic construct | HOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04346 | RIIIK [L1I] | synthetic construct | IOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04348 | RIIIK [L1K] | synthetic construct | KOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04347 | RIIIK [L1M] | synthetic construct | MOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04349 | RIIIK [L1R] | synthetic construct | ROSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04351 | RIIIK [L1Y] | synthetic construct | YOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04329 | RIIIK [L7A] | synthetic construct | LOSCCSANLRLCOVOACKRNOCCT(nh2) | ||
P04331 | RIIIK [L9A] | synthetic construct | LOSCCSLNARLCOVOACKRNOCCT(nh2) | ||
P04340 | RIIIK [N20A] | synthetic construct | LOSCCSLNLRLCOVOACKRAOCCT(nh2) | ||
P04330 | RIIIK [N8A] | synthetic construct | LOSCCSLALRLCOVOACKRNOCCT(nh2) | ||
P04334 | RIIIK [O13A] | synthetic construct | LOSCCSLNLRLCAVOACKRNOCCT(nh2) | ||
P04336 | RIIIK [O15A] | synthetic construct | LOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04341 | RIIIK [O21A] | synthetic construct | LOSCCSLNLRLCOVOACKRNACCT(nh2) | ||
P04326 | RIIIK [O2A] | synthetic construct | LASCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04332 | RIIIK [R10A] | synthetic construct | LOSCCSLNLALCOVOACKRNOCCT(nh2) | ||
P04338 | RIIIK [R19A] | synthetic construct | LOSCCSLNLRLCOVOACKANOCCT(nh2) | ||
P04327 | RIIIK [S3A] | synthetic construct | LOACCSLNLRLCOVOACKRNOCCT(nh2) | ||
P04328 | RIIIK [S6A] | synthetic construct | LOSCCALNLRLCOVOACKRNOCCT(nh2) | ||
P04342 | RIIIK [T24A] | synthetic construct | LOSCCSLNLRLCOVOACKRNOCCA(nh2) | ||
P04335 | RIIIK [V14A] | synthetic construct | LOSCCSLNLRLCOAOACKRNOCCT(nh2) | ||
P04238 | RIIIKΔ9 | synthetic construct | LOSCCSLNLRLCOVOACKRNOCCT(nh2) | ||
P08605 | Rt27.1 | G2 superfamily | Conus rattus | RDCQRGCHGCSNVPNGCCCGNLVCQNEQRCVPKE(nh2) | |
P01478 | RXIE | I1 superfamily | Conus radiatus | ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC (Btr)VDP(nh2) |
|
P02522 | S1.1 | A superfamily | Conus striatus (Striated cone) | NGCCRNPACESHRC(nh2) | |
P02482 | Scratcher peptide | Conus geographus (Geography cone) | KFLSGGFK(Gla)IVCHRYCAKGIAKEFCNCPD(nh2) | ||
P00001 | SI | A superfamily | Conus striatus (Striated cone) | ICCNPACGPKYSC(nh2) | |
P04400 | SI [K10H] | synthetic construct | ICCNPACGPHYSC(nh2) | ||
P04401 | SI [K10N] | synthetic construct | ICCNPACGPNYSC(nh2) | ||
P04399 | SI [P9K] | synthetic construct | ICCNPACGKKYSC(nh2) | ||
P00025 | SIA | A superfamily | Conus striatus (Striated cone) | YCCHPACGKNFDC(nh2) | |
P02707 | SIIIA | M superfamily | Conus striatus (Striated cone) | ZNCCNGGCSSKWCRDHARCC(nh2) | |
P05703 | SIIIA[C3U,C13U] | synthetic construct | ZNUCNGGCSSKWURDHARCC(nh2) | ||
P05702 | SIIIA[C4U,C19U] | synthetic construct | ZNCUNGGCSSKWCRDHARUC(nh2) | ||
P05704 | SIIIA[C8U,C20U] | synthetic construct | ZNCCNGGUSSKWCRDHARCU(nh2) | ||
P07461 | SIIIA[del1,D15A,H16D] | synthetic construct | NCCNGGCSSKWCRADARCC(nh2) | ||
P07460 | SIIIA[del1,D15A,H16R] | synthetic construct | NCCNGGCSSKACRARARCC(nh2) | ||
P07459 | SIIIA[del1,D15A,H16Y] | synthetic construct | NCCNGGCSSKWCRAYARCC(nh2) | ||
P05814 | SIIIA[del1,D15A,insC_A] | synthetic construct | NCCNGGCSSKWCRAHARCCA(nh2) | ||
P05815 | SIIIA[del1,D15A,insC_AA] | synthetic construct | NCCNGGCSSKWCRAHARCCAA(nh2) | ||
P05819 | SIIIA[del1,D15A,insC_AD] | synthetic construct | NCCNGGCSSKWCRAHARCCAD(nh2) | ||
P05817 | SIIIA[del1,D15A,insC_AK] | synthetic construct | NCCNGGCSSKWCRAHARCCAK(nh2) | ||
P05818 | SIIIA[del1,D15A,insC_D] | synthetic construct | NCCNGGCSSKWCRAHARCCD(nh2) | ||
P05816 | SIIIA[del1,D15A,insC_K] | synthetic construct | NCCNGGCSSKWCRAHARCCK(nh2) | ||
P05813 | SIIIA[del1,D15A] | synthetic construct | NCCNGGCSSKWCRAHARCC(nh2) | ||
P07457 | SIIIA[del1,D15K] | synthetic construct | NCCNGGCSSKWCRKHARCC(nh2) | ||
P07455 | SIIIA[del1,H16A] | synthetic construct | NCCNGGCSSKWCRDAARCC(nh2) | ||
P07465 | SIIIA[del1,K11A,R14A,D15A,H16D,R18A] | synthetic construct | NCCNGGCSSAWCAADAACC(nh2) | ||
P07464 | SIIIA[del1,K11A,R14A,D15A,H16Y,R18A] | synthetic construct | NCCNGGCSSAWCAAYAACC(nh2) | ||
P07463 | SIIIA[del1,K11A,R14A,D15A,R18A] | synthetic construct | NCCNGGCSSAWCAAHAACC(nh2) | ||
P07452 | SIIIA[del1,K11A] | synthetic construct | NCCNGGCSSAWCRDHARCC(nh2) | ||
P07462 | SIIIA[del1,K11R,W12A,D15A] | synthetic construct | NCCNGGCSSRACRAHARCC(nh2) | ||
P07458 | SIIIA[del1,K11R,W12A] | synthetic construct | NCCNGGCSSRACRDHARCC(nh2) | ||
P07454 | SIIIA[del1,R14A] | synthetic construct | NCCNGGCSSKWCADHARCC(nh2) | ||
P07456 | SIIIA[del1,R18A] | synthetic construct | NCCNGGCSSKWCRDHAACC(nh2) | ||
P07453 | SIIIA[del1,W12A] | synthetic construct | NCCNGGCSSKACRDHARCC(nh2) | ||
P05812 | SIIIA[del1] | synthetic construct | NCCNGGCSSKWCRDHARCC(nh2) | ||
P01615 | SIIIB | M superfamily | Conus striatus (Striated cone) | ZNCCNGGCSSKWCKGHARCC(nh2) | |
P07451 | SIIIB[del1] | synthetic construct | NCCNGGCSSKWCKGHARCC(nh2) | ||
P02524 | SIVA | A superfamily | Conus striatus (Striated cone) | ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2) | |
P02525 | SIVB | A superfamily | Conus striatus (Striated cone) | ZKELVP(gSr)VITTCCGYDOGTMCOOCRCTNSCOTKOKKO (nh2) |
|
P10735 | SIVC | Conus striatus (Striated cone) | AOALVV(gTr)A(gTr)TNCCGYTGOACHOCLCTQTC(nh2) | ||
P02980 | Sm1.1 | A superfamily | Conus stercusmuscarum | GRCCHPACGONYSC(nh2) | |
P02903 | Sm1.3 | A superfamily | Conus stercusmuscarum | GCCSNPVCHLEHSN(Mox)C(nh2) | |
P05838 | Sm1.4 | Conus stercusmuscarum | I(Mox)YDCCSGSCSGYTGRC(nh2) | ||
P02530 | SmIVA | A superfamily | Conus stercusmuscarum | ZTWLVP(gSr)(gTr)ITTCCGYDOGTMCOTCMCDNTCKOK OKKS(nh2) |
|
P02529 | SmIVB | A superfamily | Conus stercusmuscarum | ZPWLVP(gSr)(gTr)ITTCCGYDOGSMCOOCMCNNTCKOK OKKS(nh2) |
|
P01540 | SO3 | O1 superfamily | Conus striatus (Striated cone) | CKAAGKPCSRIAYNCCTGSCRSGKC(nh2) | |
P03902 | Sr1.1 | synthetic construct | RTCCSROTCRMEYPELCG(nh2) | ||
P03646 | Sr5.6/Sr5.8 | T superfamily | Conus spurius | IMAGCCPRFYQCCYP(nh2) | |
P03752 | SrIA | A superfamily | Conus spurius | RTCCSROTCRM(Gla)YP(Gla)LCG(nh2) | |
P03901 | SrIB | A superfamily | Conus spurius | RTCCSROTCRMEYP(Gla)LCG(nh2) | |
P04445 | SrIB [Gla15E] | synthetic construct | RTCCSROTCRMEYPELCG(nh2) | ||
P01450 | SrVIIA | O1 superfamily | Conus spurius | CLQFGSTCFLGDDDICCSGECFYSGGTFGICS(nh2) | |
P02802 | SrXIA | I2 superfamily | Conus spurius | CRTEGMSC(Gla)(Gla)NQQCCWRSCCRGECEAPCRFGP(nh2) | |
P01794 | SVIA | O1 superfamily | Conus striatus (Striated cone) | CRSSGSOCGVTSICCGRCYRGKCT(nh2) | |
P01793 | SVIB | O1 superfamily | Conus striatus (Striated cone) | CKLKGQSCRKTSYDCCSGSCGRSGKC(nh2) | |
P03584 | SxIIIA | M superfamily | Conus striolatus | RCCTGKKGSCSGRACKNLKCCA(nh2) | |
P03585 | SxIIIB | M superfamily | Conus striolatus | ZKCCTGKKGSCSGRACKNLRCCA(nh2) | |
P09774 | SxIIIC | Conus striolatus | RGCCNGRGGCSSRWCRDHARCC(nh2) | ||
P02568 | TeAr151 | T superfamily | Conus textile (Cloth-of-gold cone) | VCCRPMQDCCS(nh2) | |
P01810 | Textile convulsant peptide | O1 superfamily | Conus textile (Cloth-of-gold cone) | NCPYCVVYCCPPAYCEASGCRPP(nh2) | |
P09168 | thyrostimulin-beta 5 | Conus victoriae | TTLQCHVRSYTFRATKPPIVNENGDPVTCQGDVRVSSCWGR CDSSEIGDYKMPFKISNHPVCTYTGRVSRTVRLSQCAGYPD PTVQVFDATGCACQFCNSETQLCEKLN(nh2) |
||
P01634 | TIA | A superfamily | Conus tulipa (tulip cone) | FNWRCCLIPACRRNHKKFC(nh2) | |
P07441 | TIA[del1-2] | synthetic construct | WRCCLIPACRRNHKKFC(nh2) | ||
P07442 | TIA[del1-3] | synthetic construct | RCCLIPACRRNHKKFC(nh2) | ||
P07443 | TIA[del1-4] | synthetic construct | CCLIPACRRNHKKFC(nh2) | ||
P07440 | TIA[del1] | synthetic construct | NWRCCLIPACRRNHKKFC(nh2) | ||
P07444 | TIA[del6-19] | synthetic construct | FNWRC(nh2) | ||
P09041 | TIA[del7-19] | synthetic construct | FNWRCC(nh2) | ||
P07449 | TIA[I8A] | synthetic construct | FNWRCCLAPACRRNHKKFC(nh2) | ||
P07448 | TIA[L7A] | synthetic construct | FNWRCCAIPACRRNHKKFC(nh2) | ||
P07445 | TIA[N2A] | synthetic construct | FAWRCCLIPACRRNHKKFC(nh2) | ||
P07450 | TIA[R12A] | synthetic construct | FNWRCCLIPACARNHKKFC(nh2) | ||
P07447 | TIA[R4A] | synthetic construct | FNWACCLIPACRRNHKKFC(nh2) | ||
P07446 | TIA[W3A] | synthetic construct | FNARCCLIPACRRNHKKFC(nh2) | ||
P04228 | TiIA | Conus tinianus | GGCCSHPACQNNPD(sTy)C(nh2) | ||
P01616 | TIIIA | M superfamily | Conus tulipa (tulip cone) | RHGCCKGOKGCSSRECROQHCC(nh2) | |
P05821 | TIIIA[E15A,insC_A] | synthetic construct | RHGCCKGOKGCSSRACROQHCCA(nh2) | ||
P05822 | TIIIA[E15A,insC_AA] | synthetic construct | RHGCCKGOKGCSSRACROQHCCAA(nh2) | ||
P05826 | TIIIA[E15A,insC_AD] | synthetic construct | RHGCCKGOKGCSSRACROQHCCAD(nh2) | ||
P05825 | TIIIA[E15A,insC_AK] | synthetic construct | RHGCCKGOKGCSSRACROQHCCAK(nh2) | ||
P05824 | TIIIA[E15A,insC_D] | synthetic construct | RHGCCKGOKGCSSRACROQHCCD(nh2) | ||
P05823 | TIIIA[E15A,insC_K] | synthetic construct | RHGCCKGOKGCSSRACROQHCCK(nh2) | ||
P05820 | TIIIA[E15A] | synthetic construct | RHGCCKGOKGCSSRACROQHCC(nh2) | ||
P02712 | Ts-011 | T superfamily | Conus tessulatus | GCCEDKTCCFI(nh2) | |
P02715 | Tx-D021 | T superfamily | Conus textile (Cloth-of-gold cone) | SGCCVIDSNCC(nh2) | |
P02716 | Tx1 | A superfamily | Conus textile (Cloth-of-gold cone) | PECCSDPRCNSSHPELCG(nh2) | |
P03755 | Tx10b | Conus textile (Cloth-of-gold cone) | DPCCGYRMCVOC(nh2) | ||
P03754 | Tx10c | Conus textile (Cloth-of-gold cone) | ZTCCGYRMCVOC(nh2) | ||
P03753 | Tx1c | Conus textile (Cloth-of-gold cone) | GCCSRPPCIANNPDIC(nh2) | ||
P04977 | Tx3-L02 | M superfamily | Conus textile (Cloth-of-gold cone) | QCCDSNSCEYPKCLCCN(nh2) | |
P04978 | Tx3-L03 | M superfamily | Conus textile (Cloth-of-gold cone) | QCCDRNSCEYPKCLCCN(nh2) | |
P02560 | Tx3a | M superfamily | Conus textile (Cloth-of-gold cone) | CCSWDVCDHPSCTCCG(nh2) | |
P02564 | Tx3f | M superfamily | Conus textile (Cloth-of-gold cone) | RCCKFPCPDSCRYLCC(nh2) | |
P02565 | Tx3h | M superfamily | Conus textile (Cloth-of-gold cone) | KFCCDSNWCHISDCECCY(nh2) | |
P05831 | Tx3i | Conus textile (Cloth-of-gold cone) | CCGOTACLAGCKPCC(nh2) | ||
P02561 | Tx5.1 | T superfamily | Conus textile (Cloth-of-gold cone) | CCQTFYWCCVQ(nh2) | |
P05827 | Tx5.2 | Conus textile (Cloth-of-gold cone) | CCPPVIWCC(nh2) | ||
P05828 | Tx5.3 | Conus textile (Cloth-of-gold cone) | QTCCGSKVFCC(nh2) | ||
P05833 | Tx5.5 | Conus textile (Cloth-of-gold cone) | NIQIICCKHTPKCCT(nh2) | ||
P03756 | Tx5c | Conus textile (Cloth-of-gold cone) | KPCCSIHDNSCCGI(nh2) | ||
P03758 | Tx5d | Conus textile (Cloth-of-gold cone) | NIQIICCKHTPACCT(nh2) | ||
P05864 | Tx5e | Conus textile (Cloth-of-gold cone) | PCCSKLHDNSCCGL(nh2) | ||
P05837 | Tx6.6 | O1 superfamily | Conus textile (Cloth-of-gold cone) | DCQEKWDYCPVPFLGSRYCCDGFICPSFFCA(nh2) | |
P02881 | TxIA | A superfamily | Conus textile (Cloth-of-gold cone) | GCCSRPPCIANNPDLC(nh2) | |
P10441 | TxIA[A10L, ribbon] | synthetic construct | GCCSRPPCILNNPDLC(nh2) | ||
P08958 | TxIA[A10L] | synthetic construct | GCCSRPPCILNNPDLC(nh2) | ||
P09049 | TxIA[beads] | synthetic construct | GCCSRPPCIANNPDLC(nh2) | ||
P10443 | TxIA[ins5_A, A10L, ribbon] | synthetic construct | GCCSARPPCILNNPDLC(nh2) | ||
P10442 | TxIA[insA5; A10L] | synthetic construct | GCCSARPPCILNNPDLC(nh2) | ||
P08959 | TxIA[ribbon] | synthetic construct | GCCSRPPCIANNPDLC(nh2) | ||
P05345 | TxIB | Conus textile (Cloth-of-gold cone) | GCCSDPPCRNKHPDLC(nh2) | ||
P09987 | TxIB[C1Xch,C3Xch] | synthetic construct | G(Xch)CSDPP(Xch)RNKHPDLC(nh2) | ||
P09986 | TxIB[C2Xch,C4Xch] | synthetic construct | GC(Xch)SDPPCRNKHPDL(Xch)(nh2) | ||
P08486 | TxIB[K11A] | synthetic construct | GCCSDPPCRNAHPDLC(nh2) | ||
P05832 | TxIC | T superfamily | Conus textile (Cloth-of-gold cone) | DKQTCCGYRMCVOC(nh2) | |
P06831 | TxID | Conus textile (Cloth-of-gold cone) | GCCSHPVCSAMSPIC(nh2) | ||
P08418 | TxID[S9(Abu)] | synthetic construct | GCCSHPVC(Abu)AMSPIC(nh2) | ||
P08412 | TxID[S9A] | synthetic construct | GCCSHPVCAAMSPIC(nh2) | ||
P08429 | TxID[S9d] | synthetic construct | GCCSHPVCdAMSPIC(nh2) | ||
P08423 | TxID[S9D] | synthetic construct | GCCSHPVCDAMSPIC(nh2) | ||
P08426 | TxID[S9E] | synthetic construct | GCCSHPVCEAMSPIC(nh2) | ||
P08420 | TxID[S9F] | synthetic construct | GCCSHPVCFAMSPIC(nh2) | ||
P08424 | TxID[S9H] | synthetic construct | GCCSHPVCHAMSPIC(nh2) | ||
P08425 | TxID[S9K] | synthetic construct | GCCSHPVCKAMSPIC(nh2) | ||
P08419 | TxID[S9L] | synthetic construct | GCCSHPVCLAMSPIC(nh2) | ||
P08422 | TxID[S9R] | synthetic construct | GCCSHPVCRAMSPIC(nh2) | ||
P08428 | TxID[S9r] | synthetic construct | GCCSHPVCrAMSPIC(nh2) | ||
P08427 | TxID[S9s] | synthetic construct | GCCSHPVCsAMSPIC(nh2) | ||
P08417 | TxID[S9T] | synthetic construct | GCCSHPVCTAMSPIC(nh2) | ||
P08421 | TxID[S9Y] | synthetic construct | GCCSHPVCYAMSPIC(nh2) | ||
P02563 | TxIIIB | M superfamily | Conus textile (Cloth-of-gold cone) | CCPPVACNMGCKPCC(nh2) | |
P02562 | TxIIIC | M superfamily | Conus textile (Cloth-of-gold cone) | CCRTCFGCTOCC(nh2) | |
P02559 | TxIXA | P superfamily | Conus textile (Cloth-of-gold cone) | GCNNSCQ(Gla)HSDC(Gla)SHCICTFRGCGAVN(nh2) | |
P03170 | TxMLKM-021 | M superfamily | Conus textile (Cloth-of-gold cone) | VCCPFGGCHELCQCCE(nh2) | |
P01517 | TxVIIA | O2 superfamily | Conus textile (Cloth-of-gold cone) | CGGYSTYC(Gla)VDS(Gla)CCSDNCVRSYCTLF(nh2) | |
P02551 | TxX | I2 superfamily | Conus textile (Cloth-of-gold cone) | SCDS(Gla)FSS(Gla)FC(Gla)RP(Gla)(Gla)SCSCS THTCCHWARRDQCMKPQRCISAQKGN(nh2) |
|
P02552 | TxXI | I2 superfamily | Conus textile (Cloth-of-gold cone) | CIP(Gla)GSSCSSSGSCCHKSCCRWTCNQPCLIP(nh2) | |
P00004 | Vc1.1 | synthetic construct | GCCSDPRCNYDHPEIC(nh2) | ||
P06292 | Vc1.1 [C2(Agl),C8(Agl)] | synthetic construct | G(Agl)CSDPR(Agl)NYDHPEIC(nh2) | ||
P09975 | Vc1.1 [C2(Alk),C8(Alk)] | synthetic construct | G(Alk)CSDPR(Alk)NYDHPEIC(nh2) | ||
P09976 | Vc1.1 [C2(Aly),C8(Aly)] | synthetic construct | G(Aly)CSDPR(Aly)NYDHPEIC(nh2) | ||
P06293 | Vc1.1 [C3(Agl),C16(Agl)] | synthetic construct | GC(Agl)SDPRCNYDHPEI(Agl)(nh2) | ||
P04467 | Vc1.1 [E14Gla] | synthetic construct | GCCSDPRCNYDHP(Gla)IC(nh2) | ||
P04466 | Vc1.1 [P6O] | synthetic construct | GCCSDORCNYDHPEIC(nh2) | ||
P09082 | Vc1.1 N-term benzoylated | synthetic construct | (Bnz)GCCSDPRCNYDHPEIC(nh2) | ||
P08436 | Vc1.1[C2H,C8F] | synthetic construct | GHCSDPRFNYDHPEIC(nh2) | ||
P09010 | Vc1.1[D11(Gla)] | synthetic construct | GCCSDPRCNY(Gla)HPEIC(nh2) | ||
P03654 | Vc1.1[D11A] | synthetic construct | GCCSDPRCNYAHPEIC(nh2) | ||
P09009 | Vc1.1[D11E] | synthetic construct | GCCSDPRCNYEHPEIC(nh2) | ||
P03665 | Vc1.1[D11K] | synthetic construct | GCCSDPRCNYKHPEIC(nh2) | ||
P09073 | Vc1.1[D11N] | synthetic construct | GCCSDPRCNYNHPEIC(nh2) | ||
P03649 | Vc1.1[D5A] | synthetic construct | GCCSAPRCNYDHPEIC(nh2) | ||
P03661 | Vc1.1[D5K] | synthetic construct | GCCSKPRCNYDHPEIC(nh2) | ||
P07439 | Vc1.1[del 9-16, C3S] | synthetic construct | GCSSDPRC(nh2) | ||
P09081 | Vc1.1[del1G,N9R] | synthetic construct | CCSDPRCRYDHPEIC(nh2) | ||
P03657 | Vc1.1[E14A] | synthetic construct | GCCSDPRCNYDHPAIC(nh2) | ||
P03679 | Vc1.1[E14D] | synthetic construct | GCCSDPRCNYDHPDIC(nh2) | ||
P03668 | Vc1.1[E14K] | synthetic construct | GCCSDPRCNYDHPKIC(nh2) | ||
P03647 | Vc1.1[G1A] | synthetic construct | ACCSDPRCNYDHPEIC(nh2) | ||
P03671 | Vc1.1[G1D] | synthetic construct | DCCSDPRCNYDHPEIC(nh2) | ||
P03659 | Vc1.1[G1K] | synthetic construct | KCCSDPRCNYDHPEIC(nh2) | ||
P03655 | Vc1.1[H12A] | synthetic construct | GCCSDPRCNYDAPEIC(nh2) | ||
P03677 | Vc1.1[H12D] | synthetic construct | GCCSDPRCNYDDPEIC(nh2) | ||
P03666 | Vc1.1[H12K] | synthetic construct | GCCSDPRCNYDKPEIC(nh2) | ||
P03658 | Vc1.1[I15A] | synthetic construct | GCCSDPRCNYDHPEAC(nh2) | ||
P03680 | Vc1.1[I15D] | synthetic construct | GCCSDPRCNYDHPEDC(nh2) | ||
P03669 | Vc1.1[I15K] | synthetic construct | GCCSDPRCNYDHPEKC(nh2) | ||
P03652 | Vc1.1[N9A] | synthetic construct | GCCSDPRCAYDHPEIC(nh2) | ||
P09011 | Vc1.1[N9A] | synthetic construct | GCCSDPRCAYDHPEIC(nh2) | ||
P03675 | Vc1.1[N9D] | synthetic construct | GCCSDPRCDYDHPEIC(nh2) | ||
P05356 | Vc1.1[N9F] | synthetic construct | GCCSDPRCFYDHPEIC(nh2) | ||
P03683 | Vc1.1[N9G] | synthetic construct | GCCSDPRCGYDHPEIC(nh2) | ||
P03681 | Vc1.1[N9I] | synthetic construct | GCCSDPRCIYDHPEIC(nh2) | ||
P03664 | Vc1.1[N9K] | synthetic construct | GCCSDPRCKYDHPEIC(nh2) | ||
P03682 | Vc1.1[N9L] | synthetic construct | GCCSDPRCLYDHPEIC(nh2) | ||
P09076 | Vc1.1[N9R,D11N] | synthetic construct | GCCSDPRCRYNHPEIC(nh2) | ||
P09078 | Vc1.1[N9R,D11R] | synthetic construct | GCCSDPRCRYRHPEIC(nh2) | ||
P09077 | Vc1.1[N9R,D11S] | synthetic construct | GCCSDPRCRYSHPEIC(nh2) | ||
P09079 | Vc1.1[N9R] | synthetic construct | GCCSDPRCRYDHPEIC(nh2) | ||
P09080 | Vc1.1[N9R] acetylated | synthetic construct | (Ac)GCCSDPRCRYDHPEIC(nh2) | ||
P09075 | Vc1.1[N9R] N-term benzoylated | synthetic construct | (Bnz)GCCSDPRCRYDHPEIC(nh2) | ||
P09074 | Vc1.1[N9S,Y10V,D11N,I15L] | synthetic construct | GCCSDPRCSVNHPELC(nh2) | ||
P05357 | Vc1.1[N9W] | synthetic construct | GCCSDPRCWYDHPEIC(nh2) | ||
P09012 | Vc1.1[N9W] | synthetic construct | GCCSDPRCWYDHPEIC(nh2) | ||
P03656 | Vc1.1[P13A] | synthetic construct | GCCSDPRCNYDHAEIC(nh2) | ||
P03678 | Vc1.1[P13D] | synthetic construct | GCCSDPRCNYDHDEIC(nh2) | ||
P03667 | Vc1.1[P13K] | synthetic construct | GCCSDPRCNYDHKEIC(nh2) | ||
P09005 | Vc1.1[P6(Hyp)] | synthetic construct | GCCSDORCNYDHPEIC(nh2) | ||
P03650 | Vc1.1[P6A] | synthetic construct | GCCSDARCNYDHPEIC(nh2) | ||
P03673 | Vc1.1[P6D] | synthetic construct | GCCSDDRCNYDHPEIC(nh2) | ||
P03662 | Vc1.1[P6K] | synthetic construct | GCCSDKRCNYDHPEIC(nh2) | ||
P03651 | Vc1.1[R7A] | synthetic construct | GCCSDPACNYDHPEIC(nh2) | ||
P03674 | Vc1.1[R7D] | synthetic construct | GCCSDPDCNYDHPEIC(nh2) | ||
P03663 | Vc1.1[R7K] | synthetic construct | GCCSDPKCNYDHPEIC(nh2) | ||
P09013 | Vc1.1[S4(Dab),N9A] | synthetic construct | GCC(Dab)DPRCAYDHPEIC(nh2) | ||
P09014 | Vc1.1[S4(Dab),N9W] | synthetic construct | GCC(Dab)DPRCWYDHPEIC(nh2) | ||
P09003 | Vc1.1[S4(Dab)] | synthetic construct | GCC(Dab)DPRCNYDHPEIC(nh2) | ||
P09004 | Vc1.1[S4(Dap)] | synthetic construct | GCC(Dap)DPRCNYDHPEIC(nh2) | ||
P03648 | Vc1.1[S4A] | synthetic construct | GCCADPRCNYDHPEIC(nh2) | ||
P03672 | Vc1.1[S4D] | synthetic construct | GCCDDPRCNYDHPEIC(nh2) | ||
P03685 | Vc1.1[S4K,N9A] | synthetic construct | GCCKDPRCAYDHPEIC(nh2) | ||
P09002 | Vc1.1[S4K] | synthetic construct | GCCKDPRCNYDHPEIC(nh2) | ||
P03660 | Vc1.1[S4K] | synthetic construct | GCCKDPRCNYDHPEIC(nh2) | ||
P03684 | Vc1.1[S4R] | synthetic construct | GCCRDPRCNYDHPEIC(nh2) | ||
P09007 | Vc1.1[Y10(F(4-Cl))] | synthetic construct | GCCSDPRCN(F(4-Cl))DHPEIC(nh2) | ||
P09008 | Vc1.1[Y10(F(4-F))] | synthetic construct | GCCSDPRCN(F(4-F))DHPEIC(nh2) | ||
P03653 | Vc1.1[Y10A] | synthetic construct | GCCSDPRCNADHPEIC(nh2) | ||
P03676 | Vc1.1[Y10D] | synthetic construct | GCCSDPRCNDDHPEIC(nh2) | ||
P09006 | Vc1.1[Y10F] | synthetic construct | GCCSDPRCNFDHPEIC(nh2) | ||
P03670 | Vc1.1[Y10K] | synthetic construct | GCCSDPRCNKDHPEIC(nh2) | ||
P04279 | Vc6.17 | O2 superfamily | Conus victoriae | LCPDYTDPCSNAYECCSWNCHNGHCT(nh2) | |
P02539 | VcIA | A superfamily | Conus victoriae | GCCSDORCNYDHP(Gla)IC(nh2) | |
P02540 | VcVA | T superfamily | Conus victoriae | CCPGKOCCRI(nh2) | |
P02541 | VcVB | T superfamily | Conus victoriae | CCQTFYWCCGQ(nh2) | |
P04511 | Vi11.2 | I2 superfamily | Conus virgo | CLRDGQSCGYDSDCCRYSCCWGYCDLTCLII(nh2) | |
P04515 | Vi11.3 | I2 superfamily | Conus virgo | CFPPGVYCTRHLPCCRGRCCSGWCRPRCFPRF(nh2) | |
P04514 | Vi11.5 | I2 superfamily | Conus virgo | CRLEGSSCRRSYQCCHKSCCIRECKFPCRWV(nh2) | |
P02788 | Vi1361 | Conus virgo | ZCCPTMPECCRI(nh2) | ||
P04519 | Vi6.7 | O3 superfamily | Conus virgo | TVDEACNEYCEERNKNCCGRTDGEPVCAQACL(nh2) | |
P06858 | ViIA | A superfamily | Conus virgo | RDCCSNPPCAHNNPDC(nh2) | |
P06861 | ViIA[R1A] | synthetic construct | ADCCSNPPCAHNNPDC(nh2) | ||
P06864 | VilA deamidated | synthetic construct | RDCCSNPPCAHNNPD(nh2) | ||
P06862 | VilA[D2A] | synthetic construct | RACCSNPPCAHNNPDC(nh2) | ||
P06863 | VilA[H11A] | synthetic construct | RDCCSNPPCAANNPDC(nh2) | ||
P06860 | VilA[ins15_L] | synthetic construct | RDCCSNPPCAHNNPDLC(nh2) | ||
P01672 | ViVA | T superfamily | Conus virgo | ZCCITIPECCRI(nh2) | |
P01671 | ViVB | T superfamily | Conus virgo | ZCCPTIPECCRV(nh2) | |
P02836 | ViXVA | V superfamily | Conus virgo | DCTTCAGEECCGRCTCPWGDNCSCIEW(nh2) | |
P01390 | Vn6A | Conus ventricosus | EDCIAVGQLCVFWNIGRPCCSGLCVFACTVKLP(nh2) | ||
P04985 | Vr3-T05 | M superfamily | Conus varius | EIILHALGTRCCSWDVCDHPSCTCC(nh2) | |
P02837 | Vt15.1 | V superfamily | Conus vitulinus | ACHTCDDGTECCDSRCSCPWNTCTCIPW(nh2) | |
P04220 | Vt3.1 | M superfamily | Conus vitulinus | GPYRRYGNCYCPI(nh2) | |
P04233 | Vt3.2 | M superfamily | Conus vitulinus | GPYRRHGNCFCPS(nh2) |
ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.
The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).
Contacts:
David Craik
Quentin Kaas
Last updated: Sunday 2 April 2023