Protein List

Your search: PTM in [C-term amidation]

Found 1244 entries.

ID Name Gene superfamily Organism Sequence
P09947 [S4Hse]PeIA synthetic construct GCC(Hse)HPACSVNHPELC(nh2)
P09944 [S4I]PeIA synthetic construct GCCIHPACSVNHPELC(nh2)
P09946 [S4L]PeIA synthetic construct GCCLHPACSVNHPELC(nh2)
P09945 [S4T]PeIA synthetic construct GCCTHPACSVNHPELC(nh2)
P09943 [S4V]PeIA synthetic construct GCCVHPACSVNHPELC(nh2)
P04258 Ac-AuIB synthetic construct (Ac)GCCSYPPCFATNPDC(nh2)
P04404 Ac-ImI synthetic construct (Ac)GCCSDPRCAWRC(nh2)
P04343 Ac-L1 synthetic construct (Ac)LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P03833 Ac1.1a A superfamily Conus achatinus NGRCCHPACGKHFNC(nh2)
P02485 Ac1.1b A superfamily Conus achatinus NGRCCHPACGKHFSC(nh2)
P04393 Ac1.1b [Del1] synthetic construct GRCCHPACGKHFSC(nh2)
P02487 Ac4.2 A superfamily Conus achatinus APWMVVTATTNCCGYTGPACHPCLCTQSC(nh2)
P02489 Ac4.3a A superfamily Conus achatinus QKELVVTATTTCCGYNPMTSCPRCMCDSSCNKKKK(nh2)
P02490 Ac4.3b A superfamily Conus achatinus QKELVPSKITTCCGYSPGTACPSCMCTNTCKKKNKKP(nh2)
P08385 Am1.3 A superfamily Conus amadis GCCSVPPCIANHPELC(nh2)
P01630 Am2766 O1 superfamily Conus amadis CKQAGESCDIFSQNCCVGTCAFICIE(nh2)
P08380 Am3.1 M superfamily Conus amadis GCCPALACAMGCRPCC(nh2)
P08387 Am3.3 M superfamily Conus amadis GCCMPLSCMLLCEPCC(nh2)
P08393 Am3.4 M superfamily Conus amadis CCKYGWTCWLGCSPCC(nh2)
P02501 AnIA Conus anemone CCSHPACAANNQD(sTy)C(nh2)
P00015 AnIB Conus anemone GGCCSHPACAANNQD(sTy)C(nh2)
P04396 AnIB [Del1] synthetic construct GCCSHPACAANNQD(sTy)C(nh2)
P04394 AnIB [sTy16Y] synthetic construct GGCCSHPACAANNQDYC(nh2)
P00017 AnIC Conus anemone GGCCSHPACFASNPD(sTy)C(nh2)
P04232 Ar1446 Conus araneosus CCRLACGLGCHOCC(nh2)
P05524 As25a Conus austini CKCOSCNFNDVTENCKCCIFRQO(nh2)
P08781 Asi14.1 Conus asiaticus SCGYPCSHCGIPGCYPG(nh2)
P08782 Asi3.1 Conus asiaticus CCQWPCSHGCIPCCY(nh2)
P00404 AuIA A superfamily Conus aulicus GCCSYPPCFATNSDYC(nh2)
P00095 AuIB A superfamily Conus aulicus GCCSYPPCFATNPDC(nh2)
P08448 AuIB [N12A,ribbon] synthetic construct GCCSYPPCFATAPDC(nh2)
P04480 AuIB [ribbon] synthetic construct GCCSYPPCFATNPDC(nh2)
P08440 AuIB[C2H,C8F] synthetic construct GHCSYPPFFATNPDC(nh2)
P08450 AuIB[D14A,ribbon] synthetic construct GCCSYPPCFATNPAC(nh2)
P08796 AuIB[D14A] synthetic construct GCCSYPPCFATNPAC(nh2)
P07421 AuIB[F9(Nal)] synthetic construct GCCSYPPC(Nal)ATNPDC(nh2)
P08446 AuIB[F9A,ribbon] synthetic construct GCCSYPPCAATNPDC(nh2)
P07416 AuIB[F9A] synthetic construct GCCSYPPCAATNPDC(nh2)
P07418 AuIB[F9G] synthetic construct GCCSYPPCGATNPDC(nh2)
P07420 AuIB[F9W] synthetic construct GCCSYPPCWATNPDC(nh2)
P07419 AuIB[F9Y] synthetic construct GCCSYPPCYATNPDC(nh2)
P08441 AuIB[G1A,ribbon] synthetic construct ACCSYPPCFATNPDC(nh2)
P07414 AuIB[G1A] synthetic construct ACCSYPPCFATNPDC(nh2)
P08794 AuIB[N12A] synthetic construct GCCSYPPCFATAPDC(nh2)
P07422 AuIB[N12H] synthetic construct GCCSYPPCFATHPDC(nh2)
P08449 AuIB[P13A,ribbon] synthetic construct GCCSYPPCFATNADC(nh2)
P08795 AuIB[P13A] synthetic construct GCCSYPPCFATNADC(nh2)
P08444 AuIB[P6A,ribbon] synthetic construct GCCSYAPCFATNPDC(nh2)
P07415 AuIB[P6A] synthetic construct GCCSYAPCFATNPDC(nh2)
P08445 AuIB[P7A,ribbon] synthetic construct GCCSYPACFATNPDC(nh2)
P08451 AuIB[P7A] synthetic construct GCCSYPACFATNPDC(nh2)
P08792 AuIB[P7A] synthetic construct GCCSYPACFATNPDC(nh2)
P08442 AuIB[S4A,ribbon] synthetic construct GCCAYPPCFATNPDC(nh2)
P08786 AuIB[S4A] synthetic construct GCCAYPPCFATNPDC(nh2)
P08447 AuIB[T11A,ribbon] synthetic construct GCCSYPPCFAANPDC(nh2)
P08793 AuIB[T11A] synthetic construct GCCSYPPCFAANPDC(nh2)
P08443 AuIB[Y5A,ribbon] synthetic construct GCCSAPPCFATNPDC(nh2)
P07417 AuIB[Y5A] synthetic construct GCCSAPPCFATNPDC(nh2)
P00407 AuIC A superfamily Conus aulicus GCCSYPPCFATNSGYC(nh2)
P10037 Ba5.1 T superfamily Conus bayani SCCGSSNTGSCC(nh2)
P02531 Bn1.2 Conus bandanus ECCTHPACHVSHPELC(nh2)
P02483 Bn1.3 A superfamily Conus bandanus DYCCHRGPCMVWC(nh2)
P02635 BnIA A superfamily Conus bandanus GCCSHPACSVNNPDIC(nh2)
P03551 Bromocontryphan-S Conus striatus (Striated cone) GCO(Btr)EPWC(nh2)
P03552 Bromoheptapeptide Im Conus imperialis ZCGQA(Btr)C(nh2)
P09066 Bt1.10 A superfamily Conus betulinus GGCCSHPACGVNHPELC(nh2)
P07501 Bt1.8 Conus betulinus GCCSNPACILNNPNQC(nh2)
P09059 Bt5.5 T superfamily Conus betulinus SECCIRNFLCC(nh2)
P09062 Bt5.6 T superfamily Conus betulinus RPCCPRDTWCC(nh2)
P02526 BtX I2 superfamily Conus betulinus CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR
P04599 Bu10 Conus bullatus CKLSGYRCKRPKQCCNLSCGNYMC(nh2)
P04597 Bu17 Conus bullatus GLYCCQPKPNGQMMCNRWCEINSRCC(nh2)
P04575 Bu19 A superfamily Conus bullatus GCCHDIFCKHNNPDIC(nh2)
P04582 Bu23 A superfamily Conus bullatus LNDLVPQYWTECCGRIGPHCSRCICPEVVCPKN(nh2)
P04584 Bu24 A superfamily Conus bullatus YWTECCGRIGPHCSRCICPEVACPKN(nh2)
P04586 Bu25 A superfamily Conus bullatus YWTECCGRIGPHCSRCICPGVVCPKR(nh2)
P04616 Bu5 O1 superfamily Conus bullatus SCTDDFEPCEAGFENCCSKSCFEFEDVYVC(nh2)
P04618 Bu6 O1 superfamily Conus bullatus DSCVPDGDSCLFSRIPCCGTCSSRSKSCV(nh2)
P04622 Bu8 Conus bullatus CKRKGSSCRRTSYDCCTGSCRNGKC(nh2)
P10401 Bu8[N22A] synthetic construct CKRKGSSCRRTSYDCCTGSCRAGKC(nh2)
P10406 Bu8[N22S] synthetic construct CKRKGSSCRRTSYDCCTGSCRSGKC(nh2)
P10395 Bu8[R3A] synthetic construct CKAKGSSCRRTSYDCCTGSCRNGKC(nh2)
P10402 Bu8[R3G] synthetic construct CKGKGSSCRRTSYDCCTGSCRNGKC(nh2)
P10398 Bu8[R9A] synthetic construct CKRKGSSCARTSYDCCTGSCRNGKC(nh2)
P10403 Bu8[R9S] synthetic construct CKRKGSSCSRTSYDCCTGSCRNGKC(nh2)
P10400 Bu8[S12A] synthetic construct CKRKGSSCRRTAYDCCTGSCRNGKC(nh2)
P10405 Bu8[S12M] synthetic construct CKRKGSSCRRTMYDCCTGSCRNGKC(nh2)
P10397 Bu8[S6A] synthetic construct CKRKGASCRRTSYDCCTGSCRNGKC(nh2)
P10396 Bu8[S7A] synthetic construct CKRKGSACRRTSYDCCTGSCRNGKC(nh2)
P10399 Bu8[T11A] synthetic construct CKRKGSSCRRASYDCCTGSCRNGKC(nh2)
P10404 Bu8[T11L] synthetic construct CKRKGSSCRRLSYDCCTGSCRNGKC(nh2)
P00026 BuIA A superfamily Conus bullatus GCCSTPPCAVLYC(nh2)
P05871 BuIA[A9S] synthetic construct GCCSTPPCSVLYC(nh2)
P08439 BuIA[C2H,C8F] synthetic construct GHCSTPPFAVLYC(nh2)
P05873 BuIA[L11A] synthetic construct GCCSTPPCAVAYC(nh2)
P05869 BuIA[P6O] synthetic construct GCCSTOPCAVLYC(nh2)
P05870 BuIA[P7O] synthetic construct GCCSTPOCAVLYC(nh2)
P05867 BuIA[S4A] synthetic construct GCCATPPCAVLYC(nh2)
P09954 BuIA[T5A,P6O] Conus bullatus GCCSAOPCAVLYCG(nh2)
P05868 BuIA[T5A] synthetic construct GCCSAPPCAVLYC(nh2)
P05872 BuIA[V10A] synthetic construct GCCSTPPCAALYC(nh2)
P05874 BuIA[Y12A] synthetic construct GCCSTPPCAVLAC(nh2)
P03623 BuIIIA M superfamily Conus bullatus VTDRCCKGKRECGRWCRDHSRCC(nh2)
P05364 BuIIIA[del1-4] synthetic construct CCKNGKRGCGRWCRDHSRCC(nh2)
P03625 BuIIIB M superfamily Conus bullatus VGERCCKNGKRGCGRWCRDHSRCC(nh2)
P06981 BuIIIB[C13A,C24A] synthetic construct VGERCCKNGKRGAGRWCRDHSRCA(nh2)
P06979 BuIIIB[C5A,C17A] synthetic construct VGERACKNGKRGCGRWARDHSRCC(nh2)
P06983 BuIIIB[C5U,C13A,C17U,C24A] synthetic construct VGER(Sec)CKNGKRGAGRW(Sec)RDHSRCA(nh2)
P06982 BuIIIB[C5U,C6A,C17U,C23A] synthetic construct VGER(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P06998 BuIIIB[C5U,C6A,C17U,D19A,C23A] synthetic construct VGER(Sec)AKNGKRGCGRW(Sec)RAHSRAC(nh2)
P06999 BuIIIB[C5U,C6A,C17U,H20A,C23A] synthetic construct VGER(Sec)AKNGKRGCGRW(Sec)RDASRAC(nh2)
P06997 BuIIIB[C5U,C6A,C17U,R18A,C23A] synthetic construct VGER(Sec)AKNGKRGCGRW(Sec)ADHSRAC(nh2)
P07001 BuIIIB[C5U,C6A,C17U,R22A,C23A] synthetic construct VGER(Sec)AKNGKRGCGRW(Sec)RDHSAAC(nh2)
P07000 BuIIIB[C5U,C6A,C17U,S21A,C23A] synthetic construct VGER(Sec)AKNGKRGCGRW(Sec)RDHARAC(nh2)
P06993 BuIIIB[C5U,C6A,G12A,C17U,C23A] synthetic construct VGER(Sec)AKNGKRACGRW(Sec)RDHSRAC(nh2)
P06994 BuIIIB[C5U,C6A,G14A,C17U,C23A] synthetic construct VGER(Sec)AKNGKRGCARW(Sec)RDHSRAC(nh2)
P06990 BuIIIB[C5U,C6A,G9A,C17U,C23A] synthetic construct VGER(Sec)AKNAKRGCGRW(Sec)RDHSRAC(nh2)
P06991 BuIIIB[C5U,C6A,K10A,C17U,C23A] synthetic construct VGER(Sec)AKNGARGCGRW(Sec)RDHSRAC(nh2)
P06988 BuIIIB[C5U,C6A,K7A,C17U,C23A] synthetic construct VGER(Sec)AANGKRGCGRW(Sec)RDHSRAC(nh2)
P06989 BuIIIB[C5U,C6A,N8A,C17U,C23A] synthetic construct VGER(Sec)AKAGKRGCGRW(Sec)RDHSRAC(nh2)
P06992 BuIIIB[C5U,C6A,R11A,C17U,C23A] synthetic construct VGER(Sec)AKNGKAGCGRW(Sec)RDHSRAC(nh2)
P06995 BuIIIB[C5U,C6A,R15A,C17U,C23A] synthetic construct VGER(Sec)AKNGKRGCGAW(Sec)RDHSRAC(nh2)
P06996 BuIIIB[C5U,C6A,W16A,C17U,C23A] synthetic construct VGER(Sec)AKNGKRGCGRA(Sec)RDHSRAC(nh2)
P06980 BuIIIB[C6A,C23A] synthetic construct VGERCAKNGKRGCGRWCRDHSRAC(nh2)
P07003 BuIIIB[E3(Dab),C5U,C6A,C17U,C23A] synthetic construct VG(Dab)R(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P07004 BuIIIB[E3(Dap),C5U,C6A,C17U,C23A] synthetic construct VG(Dap)R(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P07002 BuIIIB[E3(Gla),C5U,C6A,C17U,C23A] synthetic construct VG(Gla)R(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P07005 BuIIIB[E3(Orn),C5U,C6A,C17U,C23A] synthetic construct VG(Orn)R(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P06986 BuIIIB[E3A,C5U,C6A,C17U,C23A] synthetic construct VGAR(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P05362 BuIIIB[E3A] synthetic construct VGARCCKNGKRGCGRWCRDHSRCC(nh2)
P07008 BuIIIB[E3H,C5U,C6A,C17U,C23A] synthetic construct VGHR(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P07006 BuIIIB[E3K,C5U,C6A,C17U,C23A] synthetic construct VGKR(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P07007 BuIIIB[E3R,C5U,C6A,C17U,C23A] synthetic construct VGRR(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P06985 BuIIIB[G2A,C5U,C6A,C17U,C23A] synthetic construct VAER(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P05361 BuIIIB[G2A] synthetic construct VAERCCKNGKRGCGRWCRDHSRCC(nh2)
P05359 BuIIIB[G2a] synthetic construct VaERCCKNGKRGCGRWCRDHSRCC(nh2)
P06987 BuIIIB[R4A,C5U,C6A,C17U,C23A] synthetic construct VGEA(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P05363 BuIIIB[R4A] synthetic construct VGEACCKNGKRGCGRWCRDHSRCC(nh2)
P06984 BuIIIB[V1A,C5U,C6A,C17U,C23A] synthetic construct AGER(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P05360 BuIIIB[V1A] synthetic construct AGERCCKNGKRGCGRWCRDHSRCC(nh2)
P03628 BuIIIC M superfamily Conus bullatus IVDRCCNKGNGKRGCSRWCRDHSRCC(nh2)
P09973 C1.3 A superfamily Conus catus GCCSNPVCHLEHSNLC(nh2)
P09974 C6.2 O1 superfamily Conus catus DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2)
P04133 Cal14.13b Divergent MKLCVVIVLL Conus californicus GIWCDPPCPEGETCRGGECSDEFNGDM(nh2)
P04134 Cal14.13c Divergent MKLCVVIVLL Conus californicus GIWCDPPCPEGETCRGGECSDEFNGDL(nh2)
P04135 Cal14.6 Divergent M---L-LTVA Conus californicus GCPADCPNTCDSSNKCSPGFP(nh2)
P04140 Cal16.1 Divergent MRCLSIFVLL Conus californicus ZGCVCNANAKFCCGE(nh2)
P08897 Cca1669 amidated synthetic construct RDCGKMCEEETWKG(nh2)
P09071 Ch1.1 A superfamily Conus chiangi GCCSDPRCAWRC(nh2)
P08016 CIA A superfamily Conus catus NGRCCHPACGKHFSC(nh2)
P08017 CIB A superfamily Conus catus GCCSNPVCHLEHPNAC(nh2)
P02855 CMrVIA [K6P] amidated synthetic construct VCCGYPLCHOC(nh2)
P02856 CMrVIA amidated synthetic construct VCCGYKLCHOC(nh2)
P01558 CnIA A superfamily Conus consors GRCCHPACGKYYSC(nh2)
P00594 CnIB A superfamily Conus consors CCHPACGKYYSC(nh2)
P04091 CnIG Conus consors CCHPACGKYFKC(nh2)
P02901 CnIH A superfamily Conus consors N
P03834 CnIIIC M superfamily Conus consors ZGCCNGPKGCSSKWCRDHARCC(nh2)
P04090 CnIJ Conus consors GR
P05353 CnIK Conus consors NGRCCHOACGKYYSC(nh2)
P05351 CnIL A superfamily Conus consors DGRCCHPACGKYYSC(nh2)
P05354 CnVA Conus consors ECCHRQLLCCLRFV(nh2)
P01632 CnVIIA O1 superfamily Conus consors CKGKGAOCTRL(Mox)YDCCHGSCSSSKGRC(nh2)
P05234 CnVIIB O1 superfamily Conus consors CKGKGASCRRTSYDCCTGSCRSGKC(nh2)
P05232 CnVIIC O1 superfamily Conus consors CKGTGKOCSRIAYNCCTGSCRSGKC(nh2)
P05233 CnVIID O1 superfamily Conus consors CKGKGASCSRTMYNCCSGSCNRGKCG(nh2)
P06935 Con-ins G1 A chain Insulin superfamily Conus geographus (Geography cone) GVV(Gla)HCCHRPCSNA(Gla)FKKYC(nh2)
P06936 Con-ins G3 B chain Insulin superfamily Conus geographus (Geography cone) NSDTPKHRCGS(Gla)LADQYVQLCH(nh2)
P09802 Conantokin Eu3 Conus eburneus GGEPRVEASRERLQEIGR(nh2)
P04643 Conantokin-Eu2 Conus eburneus GQEERAEASYEKLLEI(nh2)
P01338 Conantokin-G B1 superfamily Conus geographus (Geography cone) GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN(nh2)
P05725 Conantokin-G2 B1 superfamily Conus geographus (Geography cone) GEEEVQENQELIREASN(nh2)
P05699 Conantokin-G[+10Gla,Gla10Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Gla)(Buc)LIR(Buc)KS
P07643 conantokin-G[+10O] synthetic construct GE(Gla)(Gla)LQ(Gla)NQO(Gla)LIR(Gla)KSN(nh2)
P05698 Conantokin-G[Gla10Bsc,Gla14Bsc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Bsc)LIR(Bsc)KSN(nh2)
P05697 Conantokin-G[Gla10Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Buc)LIR(Buc)KSN(nh2)
P05700 Conantokin-G[Gla7Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Huc)NQ(Gla)LIR(Buc)KSN(nh2)
P02637 Conantokin-L B1 superfamily Conus lynceus GE(Gla)(Gla)VAKMAA(Gla)LAR(Gla)DAVN(nh2)
P04501 Conantokin-L2.2 B1 superfamily Conus litteratus GPEEDSETTVEELHEI(nh2)
P03535 Conantokin-Pr3 Conus parius GEP(Gla)VAKWA(Gla)GLR(Gla)KAASN(nh2)
P05841 Conantokin-Rl2 B1 superfamily Conus rolani GE(Gla)(Gla)LA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P05846 conantokin-Rl2[delO10] synthetic construct GE(Gla)(Gla)LA(Gla)KA(Gla)FAR(Gla)LAN(nh2)
P05848 Conantokin-Rl2[K8N,A9Q,del10O] synthetic construct GE(Gla)(Gla)LA(Gla)NQ(Gla)FAR(Gla)LAN(nh2)
P05847 Conantokin-Rl2[K8Nle] synthetic construct GE(Gla)(Gla)LA(Gla)(Nle)AO(Gla)FAR(Gla)LA
P05844 Conantokin-Rl2[L5Y] synthetic construct GE(Gla)(Gla)YA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P05845 conantokin-Rl2[O10A] synthetic construct GE(Gla)(Gla)LA(Gla)KAA(Gla)FAR(Gla)LAN(nh2)
P07642 conantokin-Rl2[O10P] synthetic construct GE(Gla)(Gla)LA(Gla)KAP(Gla)FAR(Gla)LAN(nh2)
P05851 Conantokin-Rl3 B1 superfamily Conus rolani GE(Gla)(Gla)LS(Gla)NAV(Gla)FAR(Gla)LAN(nh2)
P07401 Conantokin-SuB Conus sulcatus GE(Gla)(Gla)YS(Gla)AI(nh2)
P07411 Conantokin-SuB[A8F] synthetic construct GE(Gla)(Gla)YS(Gla)FI(nh2)
P07413 Conantokin-SuC[A6S,F8A,del10-18] synthetic construct DD(Gla)(Gla)YS(Gla)AI(nh2)
P07410 Conantokin-SuC[del10-18] synthetic construct DD(Gla)(Gla)YA(Gla)FI(nh2)
P07405 Conantokin-SuD Conus sulcatus GK(Gla)(Gla)LA(Gla)NAP(Gla)FAR(Gla)LATN(nh2)
P07407 Conantokin-SuE Conus sulcatus GE(Gla)(Gla)CS(Gla)AI(nh2)
P01269 Conantokin-T Conus tulipa (tulip cone) GE(Gla)(Gla)YQKML(Gla)NLR(Gla)AEVKKNA(nh2)
P07533 ConoCAP-Vila Conus villepinii PFCNSFGCYN(nh2)
P07532 ConoCAP-Vilb Conus villepinii VFCNGFTGCG(nh2)
P07534 ConoCAP-Vilc Conus villepinii LFCNGYGGCRG(nh2)
P02747 conolysin-Mt2 Conus mustelinus FHPSLWVLIPQYIQLIRKILKS(nh2)
P03622 Conomap-Vt Conus vitulinus AfVKGSAQRVAHGY(nh2)
P08923 conomarphin-Ac1 amidated synthetic construct NYYLYOAROENSwwT(nh2)
P08926 conomarphin-Ac1[E10(Gla), W14(Gla)] amidated synthetic construct NYYLYOARO(Gla)NSw(Gla)T(nh2)
P06673 conomarphin-Vc2 M superfamily Conus victoriae GWHYHPYQNPKPT(nh2)
P09721 conoNPY-Tx1.1 Conus textile (Cloth-of-gold cone) RPRF(nh2)
P09722 conoNPY-Tx1.2 Conus textile (Cloth-of-gold cone) VGRPRF(nh2)
P09723 conoNPY-Tx1.3 Conus textile (Cloth-of-gold cone) AIVGRPRF(nh2)
P10035 Conopressin Ba1 Conus bayani CYITNCORG(nh2)
P10143 Conopressin Ba2 Conus bayani CFLGNCLND(nh2)
P10145 Conopressin Ba3 Conus bayani CFIRNCPRG(nh2)
P08903 Conopressin M1 amidated synthetic construct CFPGNCPDS(nh2)
P08905 Conopressin M2 amidated synthetic construct CFLGNCPDS(nh2)
P05544 conopressin-Cn Conus consors CYIRDCPE(nh2)
P08954 conopressin-G Conus araneosus CFIRNCPKG(nh2)
P08953 conopressin-G Conus geographus (Geography cone) CFIRNCPKG(nh2)
P08952 conopressin-G Conus lividus CFIRNCPKG(nh2)
P01382 conopressin-G Conus imperialis CFIRNCPKG(nh2)
P08951 conopressin-G Conus loroisii CFIRNCPKG(nh2)
P08940 conopressin-M Conus monile CFIRNCPEG(nh2)
P01267 conopressin-S Conus striatus (Striated cone) CIIRNCPRG(nh2)
P03556 Conopressin-T Conus tulipa (tulip cone) CYIQNCLRV(nh2)
P08700 Conorfamide-As1a Conus austini RIKKPIFIAFPRF(nh2)
P08701 Conorfamide-As2a Conus austini RIRKPIFIAFPRF(nh2)
P09977 Conorfamide-Ep1 Conus episcopatus NFGILFYFTRPRNNFVRI(nh2)
P01317 Conorfamide-Sr1 Conus spurius GPMGWVPVFYRF(nh2)
P03538 Conorfamide-Sr2 Conus spurius GPM(Gla)DPL(Gla)IIRI(nh2)
P08699 Conorfamide-Sr3 Conus spurius ATSGPMGWLPVFYRF(nh2)
P08367 Conorfamide-Tx1 Conus textile (Cloth-of-gold cone) PGVLDIPVKSNSDDDSIFRY(nh2)
P08369 Conorfamide-Tx2 Conus textile (Cloth-of-gold cone) HSGILLAWSGPRNRFVRI(nh2)
P06810 Conorfamide-Vc1 Conus victoriae HSGFLLAWSGPRNRFVRF(nh2)
P08371 Conorfamide-Vc1 [del1-14] synthetic construct FVRF(nh2)
P08370 Conorfamide-Vc1 [del1-6] synthetic construct AWSGPRNRFVRF(nh2)
P08846 Conorphin-T[bead] T superfamily Conus textile (Cloth-of-gold cone) NCCRRQICC(nh2)
P06904 Conorphin-T[del1-3,8,9] synthetic construct RRQI(nh2)
P06906 Conorphin-T[del1-3] synthetic construct RRQICC(nh2)
P06905 Conorphin-T[del8,9] synthetic construct NCCRRQI(nh2)
P08845 Conorphin-T[globular] T superfamily Conus textile (Cloth-of-gold cone) NCCRRQICC(nh2)
P06910 Conorphin-T[I7(Cha),ribbon] synthetic construct NCCRRQ(Cha)CC(nh2)
P06912 Conorphin-T[I7(Nal),ribbon] synthetic construct NCCRRQ(Nal)CC(nh2)
P06901 Conorphin-T[I7A,ribbon] synthetic construct NCCRRQACC(nh2)
P06911 Conorphin-T[I7F,ribbon] synthetic construct NCCRRQFCC(nh2)
P06909 Conorphin-T[I7L,ribbon] synthetic construct NCCRRQLCC(nh2)
P06908 Conorphin-T[I7V,ribbon] synthetic construct NCCRRQVCC(nh2)
P08847 Conorphin-T[N1(Anc),del2-3,R4r,R5r,I7(Cha)] synthetic construct (Anc)rrQ(Cha)CC(nh2)
P06928 Conorphin-T[N1(BrBnz),del2-3,R4r,R5r,I7(Cha)] synthetic construct (3BrBnz)rrQ(Cha)CC(nh2)
P06924 Conorphin-T[N1(BrBz),del2-3,R4r,R5r,I7(Cha)] synthetic construct (3BrBz)rrQ(Cha)CC(nh2)
P08891 Conorphin-T[N1(BzP),del2-3,R4r,R5r,del6_Q,I7(Cha)] synthetic construct (BzP)rr(Cha)CC(nh2)
P08869 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Dap)] synthetic construct ZrrQ(Cha)(Dap)(nh2)
P08873 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Meg)] synthetic construct (BzP)rrQ(Cha)(Meg)C(nh2)
P08875 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Mpc)] synthetic construct (BzP)rrQ(Cha)(Mpc)C(nh2)
P08860 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Nmc)] synthetic construct (Bnz)PrrQ(Cha)(Nmc)C(nh2)
P08859 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C8(Pen)] synthetic construct (Bnz)PrrQ(Cha)(Pen)C(nh2)
P08872 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C9(Meg)] synthetic construct (BzP)rrQ(Cha)C(Meg)(nh2)
P08876 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),C9(Mpc)] synthetic construct (BzP)rrQ(Cha)C(Mpc)(nh2)
P08862 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),ins8_CH2NH] synthetic construct (BzP)rrQ(Cha)(CH3N)CC(nh2)
P08871 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha),insC_CH2] synthetic construct (BzP)rrQ(Cha)CC(CH3N)(nh2)
P08853 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha)] synthetic construct (Bnz)PrrQ(Cha)CC(nh2)
P08880 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Cha)] synthetic construct (BzP)rrQ(Cha)(nh2)
P08863 Conorphin-T[N1(BzP),del2-3,R4r,R5r,I7(Chg)] synthetic construct (BzP)rrQ(Chg)CC(nh2)
P08884 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6A,I7(Cha)] synthetic construct (BzP)rrA(Cha)CC(nh2)
P08889 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6D,I7(Cha)] synthetic construct (BzP)rrD(Cha)CC(nh2)
P08890 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6E,I7(Cha)] synthetic construct (BzP)rrE(Cha)CC(nh2)
P08887 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6F,I7(Cha)] synthetic construct (BzP)rrF(Cha)CC(nh2)
P08888 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6G,I7(Cha)] synthetic construct (BzP)rrG(Cha)CC(nh2)
P08883 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6K,I7(Cha)] synthetic construct (BzP)rrK(Cha)CC(nh2)
P08885 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6L,I7(Cha)] synthetic construct (BzP)rrL(Cha)CC(nh2)
P08881 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6N,I7(Cha)] synthetic construct (BzP)rrN(Cha)CC(nh2)
P08882 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6R,I7(Cha)] synthetic construct (BzP)rrR(Cha)CC(nh2)
P08886 Conorphin-T[N1(BzP),del2-3,R4r,R5r,Q6S,I7(Cha)] synthetic construct (BzP)rrS(Cha)CC(nh2)
P06925 Conorphin-T[N1(ClBnz),del2-3,R4r,R5r,I7(Cha)] synthetic construct (3ClBnz)rrQ(Cha)CC(nh2)
P06926 Conorphin-T[N1(ClBz),del2-3,R4r,R5r,I7(Cha)] synthetic construct (3ClBz)rrQ(Cha)CC(nh2)
P08855 Conorphin-T[N1(ClBzP),del2-3,R4r,R5r,I7(Cha),ins6_C] synthetic construct (ClBzP)rrQC(Cha)CC(nh2)
P08852 Conorphin-T[N1(ClBzP),del2-3,R4r,R5r,I7(Cha)] synthetic construct (4ClBz)rrQ(Cha)CC(nh2)
P06927 Conorphin-T[N1(FBnz),del2-3,R4r,R5r,I7(Cha)] synthetic construct (4FBnz)rrQ(Cha)CC(nh2)
P06923 Conorphin-T[N1(FBz),del2-3,R4r,R5r,I7(Cha)] synthetic construct (4FBz)rrQ(Cha)CC(nh2)
P08856 Conorphin-T[N1(HOBzP),del2-3,R4r,R5r,I7(Cha),ins6_C] synthetic construct (HOBzP)rrQC(Cha)CC(nh2)
P08854 Conorphin-T[N1(MeOBzP),del2-3,R4r,R5r,I7(Cha),ins6_C] synthetic construct (MeOBzP)rrQC(Cha)CC(nh2)
P08857 Conorphin-T[N1(NOBzP),del2-3,R4r,R5r,I7(Cha),ins6_C] synthetic construct (NOBzP)rrQC(Cha)CC(nh2)
P08851 Conorphin-T[N1(NzP),del2-3,R4r,R5r,I7(Cha)] synthetic construct (NzP)rrQ(Cha)CC(nh2)
P08848 Conorphin-T[N1(Qin),del2-3,R4r,R5r,I7(Cha)] synthetic construct (Qin)rrQ(Cha)CC(nh2)
P08867 Conorphin-T[N1(Tic),del2-3,R4r,R5r,I7(Cha),C8(Sec),C9(Sec)] synthetic construct (Tic)rrQ(Cha)(Sec)(Sec)(nh2)
P08849 Conorphin-T[N1(Tic),del2-3,R4r,R5r,I7(Cha)] synthetic construct (Tic)rrQ(Cha)CC(nh2)
P08850 Conorphin-T[N1(Tiq),del2-3,R4r,R5r,I7(Cha)] synthetic construct (Tiq)rrQ(Cha)CC(nh2)
P06907 Conorphin-T[N1U,del2,3] synthetic construct ZRRQICC(nh2)
P06919 Conorphin-T[N1U,del2-3,I7(Cha)] synthetic construct ZRRQ(Cha)CC(nh2)
P08866 Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C8(Hcy),C9(Hcy)] synthetic construct ZrrQ(Cha)(Hcy)(Hcy)(nh2)
P08864 Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C8(Hcy)] synthetic construct ZrrQ(Cha)(Hcy)C(nh2)
P08858 Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C8(Pen)] synthetic construct ZrrQ(Cha)(Pen)C(nh2)
P08868 Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C8(Sec)] synthetic construct ZrrQ(Cha)(Sec)C(nh2)
P08865 Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha),C9(Hcy)] synthetic construct ZrrQ(Cha)C(Hcy)(nh2)
P06922 Conorphin-T[N1U,del2-3,R4r,R5r,I7(Cha)] synthetic construct ZrrQ(Cha)CC(nh2)
P06921 Conorphin-T[N1U,del2-3,R5r,I7(Cha)] synthetic construct ZRrQ(Cha)CC(nh2)
P06902 Conorphin-T[N1U,ribbon] synthetic construct ZCCRRQICC(nh2)
P06903 Conorphin-T[N1Y,ribbon] synthetic construct YCCRRQICC(nh2)
P08874 Conorphin-T[N1Z,del2-3,I7(Cha),C8(Acc),del9_C] synthetic construct ZRRQ(Cha)(Acc)(nh2)
P06900 Conorphin-T[Q6A,ribbon] synthetic construct NCCRRAICC(nh2)
P06917 Conorphin-T[R4(Cit),ribbon] synthetic construct NCC(Cit)RQICC(nh2)
P06898 Conorphin-T[R4A,ribbon] synthetic construct NCCARQICC(nh2)
P06913 Conorphin-T[R4H,ribbon] synthetic construct NCCHRQICC(nh2)
P06915 Conorphin-T[R4K,ribbon] synthetic construct NCCKRQICC(nh2)
P06918 Conorphin-T[R5(Cit),ribbon] synthetic construct NCCR(Cit)QICC(nh2)
P06899 Conorphin-T[R5A,ribbon] synthetic construct NCCRAQICC(nh2)
P06914 Conorphin-T[R5H,ribbon] synthetic construct NCCRHQICC(nh2)
P06916 Conorphin-T[R5K,ribbon] synthetic construct NCCRKQICC(nh2)
P06897 Conorphin-T[ribbon] T superfamily Conus textile (Cloth-of-gold cone) NCCRRQICC(nh2)
P09801 Contryphan Eu1 Conus eburneus GCOPGLWC(nh2)
P01270 Contryphan-Am O2 superfamily Conus amadis GCOwDPWC(nh2)
P09754 Contryphan-Ar1 Conus araneosus ES(Gla)CPwHPWC(nh2)
P09753 Contryphan-Ar2 O2 superfamily Conus araneosus ES(Gla)CPwKPWC(nh2)
P08776 Contryphan-Be Conus betulinus VVGCOwQPWC(nh2)
P04624 Contryphan-Bu O2 superfamily Conus bullatus KCOwSPWC(nh2)
P09768 Contryphan-Eb O2 superfamily Conus ebraeus GCPWHPWC(nh2)
P08777 Contryphan-Fi Conus figulinus VVGCOwQPWC(nh2)
P06828 Contryphan-Fib Conus figulinus GCOWMPWC(nh2)
P09757 Contryphan-Fr1 O2 superfamily Conus frigidus GCOwDPWC(nh2)
P09767 Contryphan-Fr2 O2 superfamily Conus frigidus GCOwDSWC(nh2)
P01271 Contryphan-In Conus inscriptus GCVlYPWC(nh2)
P09769 Contryphan-Li1 O2 superfamily Conus lividus GCPWNPWC(nh2)
P09770 Contryphan-Li2 O2 superfamily Conus lividus GCPFQPWC(nh2)
P01272 Contryphan-Lo1 Conus loroisii GCPwDPWC(nh2)
P09766 Contryphan-Lo2 O2 superfamily Conus loroisii NECPwQPWC(nh2)
P02621 Contryphan-Lt1 O2 superfamily Conus litteratus GCOwEPWC(nh2)
P09772 Contryphan-Lt2 O2 superfamily Conus litteratus GCPWYPWC(nh2)
P02570 contryphan-M O2 superfamily Conus marmoreus N(Gla)S(Gla)CPwHPWC(nh2)
P05389 contryphan-M2 O2 superfamily Conus marmoreus ESECPWHPWC(nh2)
P09771 Contryphan-Mi O2 superfamily Conus miles GCPWDPWC(nh2)
P09773 Contryphan-Mo Conus monile ESECPWKPWC(nh2)
P02597 Contryphan-P O2 superfamily Conus purpurascens GCOwDPWC(nh2)
P01372 Contryphan-R O2 superfamily Conus radiatus GCOwEP(Btr)C(nh2)
P01355 Contryphan-R [Des-Gly1] synthetic construct COwQPWC(nh2)
P03549 Contryphan-S O2 superfamily Conus striatus (Striated cone) GCOwEPWC(nh2)
P01318 Contryphan-Sm O2 superfamily Conus stercusmuscarum GCOwQPWC(nh2)
P02622 Contryphan-Tx O2 superfamily Conus textile (Cloth-of-gold cone) GCOwQPYC(nh2)
P04517 Contryphan-Vi O2 superfamily Conus virgo GCPWHPWC(nh2)
P01309 Contryphan-Vn Conus ventricosus GDCPwKPWC(nh2)
P07531 Contryphan-Vn [W8S] Conus ventricosus GDCPwKPSC(nh2)
P07557 Contryphan-Ze Conus zeylanicus VVGCOwQPWC(nh2)
P02548 CVIA O1 superfamily Conus catus CKSTGASCRRTSYDCCTGSCRSGRC(nh2)
P01726 CVIB O1 superfamily Conus catus CKGKGASCRKTMYDCCRGSCRSGRC(nh2)
P01725 CVIC O1 superfamily Conus catus CKGKGQSCSKLMYDCCTGSCSRRGKC(nh2)
P02549 CVID O1 superfamily Conus catus CKSKGAKCSKLMYDCCSGSCSGTVGRC(nh2)
P04324 CVID[K10R] synthetic construct CKSKGAKCSRLMYDCCSGSCSGTVGRC(nh2)
P05863 CVID[K2A,K10R] synthetic construct CASKGAKCSRLMYDCCSGSCSGTVGRC(nh2)
P04243 CVIE O1 superfamily Conus catus CKGKGASCRRTSYDCCTGSCRSGRC(nh2)
P08607 CVIE[R10K] synthetic construct CKGKGASCRKTSYDCCTGSCRSGRC(nh2)
P08606 CVIF[R10K] synthetic construct CKGKGASCRKTSYDCCTGSCRLGRC(nh2)
P01262 Cyclic contryphan synthetic construct GCOyNPKC(nh2)
P08893 Czon1107 Conus zonatus (zoned cone) GFRSPCPPFC(nh2)
P08894 Czon1107[P5A] synthetic construct GFRSACPPFC(nh2)
P08895 Czon1107[P7A] synthetic construct GFRSPCAPFC(nh2)
P02550 De13a Conus delessertii DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG
P05522 De13b G superfamily Conus delessertii DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVRQHCSGCNH(nh2)
P01496 DeVIIA O1 superfamily Conus delessertii ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2)
P00050 EI A superfamily Conus ermineus (Atlantic fish-hunting cone) RDOCCYHPTCNMSNPQIC(nh2)
P09022 EI[D2A] synthetic construct RAOCCYHPTCNMSNPQIC(nh2)
P09036 EI[del1-2] synthetic construct OCCYHPTCNMSNPQIC(nh2)
P09037 EI[del1-3] synthetic construct CCYHPTCNMSNPQIC(nh2)
P09035 EI[del1] synthetic construct DOCCYHPTCNMSNPQIC(nh2)
P09025 EI[H7A] synthetic construct RDOCCYAPTCNMSNPQIC(nh2)
P09034 EI[I17A] synthetic construct RDOCCYHPTCNMSNPQAC(nh2)
P09029 EI[M12A] synthetic construct RDOCCYHPTCNASNPQIC(nh2)
P09028 EI[N11A] synthetic construct RDOCCYHPTCAMSNPQIC(nh2)
P09031 EI[N14A] synthetic construct RDOCCYHPTCNMSAPQIC(nh2)
P09023 EI[O3A] synthetic construct RDACCYHPTCNMSNPQIC(nh2)
P09032 EI[P15A] synthetic construct RDOCCYHPTCNMSNAQIC(nh2)
P09026 EI[P8A] synthetic construct RDOCCYHATCNMSNPQIC(nh2)
P09033 EI[Q16A] synthetic construct RDOCCYHPTCNMSNPAIC(nh2)
P09021 EI[R1A] synthetic construct ADOCCYHPTCNMSNPQIC(nh2)
P09030 EI[S13A] synthetic construct RDOCCYHPTCNMANPQIC(nh2)
P09027 EI[T9A] synthetic construct RDOCCYHPACNMSNPQIC(nh2)
P09024 EI[Y6A] synthetic construct RDOCCAHPTCNMSNPQIC(nh2)
P04069 EIIA A superfamily Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWNPACVKNRC(nh2)
P07538 EIIB Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWHPACGKNRC(nh2)
P01635 EIVA Conus ermineus (Atlantic fish-hunting cone) GCCGPYONAACHOCGCKVGROOYCDROSGG(nh2)
P01740 EIVB Conus ermineus (Atlantic fish-hunting cone) GCCGKYONAACHOCGCTVGROOYCDROSGG(nh2)
P02569 Em11.10 I2 superfamily Conus emaciatus CFPPGIYCTPYLPCCWGICCGTCRNVCHLRI(nh2)
P02577 Ep11.12 I2 superfamily Conus episcopatus CLSEGSPCSMSGSCCHKSCCRSTCTFPCLIP(nh2)
P00405 EpI A superfamily Conus episcopatus GCCSDPRCNMNNPD(sTy)C(nh2)
P00112 EpI [sTy15>Y] synthetic construct GCCSDPRCNMNNPDYC(nh2)
P04507 Eu1.3 A superfamily Conus eburneus LIAPFIRDYCCPRGPCMVWC(nh2)
P04644 Eu1.6 A superfamily Conus eburneus GCCSNPACMLKNPNLC(nh2)
P09797 Eu3.11 Conus eburneus CCQAACSPWLCLPCC(nh2)
P09803 Eu3.13 Conus eburneus DCCVMPWCDGACDCCVSS(nh2)
P09793 Eu5.13 Conus eburneus TLQRHWAKSLCCPEDAWCCSHDE(nh2)
P01561 EVIA O1 superfamily Conus ermineus (Atlantic fish-hunting cone) DDCIKOYGFCSLPILKNGLCCSGACVGVCADL(nh2)
P01575 EVIB O1 superfamily Conus ermineus (Atlantic fish-hunting cone) EACYOOGTFCGIKOGLCCSELCLPAVCVG(nh2)
P02719 Fe14.1 J superfamily Conus ferrugineus SPGSTICKMACRTGNGHKYPFCNCR(nh2)
P02720 Fe14.2 J superfamily Conus ferrugineus SSGSTVCKMMCRLGYGHLYPSCGCR(nh2)
P02656 Fi11.11 I2 superfamily Conus figulinus CHHEGLPCTSGDGCCGMECCGGVCSSHCGN(nh2)
P01307 Gamma-conopressin-vil Conus villepinii CLIQDCP(Gla)G(nh2)
P00074 GI A superfamily Conus geographus (Geography cone) ECCNPACGRHYSC(nh2)
P04398 GI [R9A] synthetic construct ECCNPACGAHYSC(nh2)
P00408 GI antitoxic analog synthetic construct CANPACGRHYS(nh2)
P09094 GI[E1A] synthetic construct ACCNPACGRHYSC(nh2)
P09097 GI[G8A] synthetic construct ECCNPACARHYSC(nh2)
P09099 GI[H10A] synthetic construct ECCNPACGRAYSC(nh2)
P09095 GI[N4A] synthetic construct ECCAPACGRHYSC(nh2)
P09096 GI[P5A] synthetic construct ECCNAACGRHYSC(nh2)
P09098 GI[R9A] synthetic construct ECCNPACGAHYSC(nh2)
P09101 GI[S12A] synthetic construct ECCNPACGRHYAC(nh2)
P09100 GI[Y11A] synthetic construct ECCNPACGRHASC(nh2)
P00132 GIC A superfamily Conus geographus (Geography cone) GCCSHPACAGNNQHIC(nh2)
P03557 GID amidated [(GLA)4E] synthetic construct IRDECCSNPACRVNNOHVC(nh2)
P00024 GII A superfamily Conus geographus (Geography cone) ECCHPACGKHFSC(nh2)
P01571 GIIIA M superfamily Conus geographus (Geography cone) RDCCTOOKKCKDRQCKOQRCCA(nh2)
P07484 GIIIA [A10C, A21C] M superfamily Conus geographus (Geography cone) RDCCTOOKKAKDRQCKOQRCAA(nh2)
P07486 GIIIA [A3C,A10C,A15C,A21C] M superfamily Conus geographus (Geography cone) RDACTOOKKAKDRQAKOQRCAA(nh2)
P07488 GIIIA [A3C,A4C,A10C,A15C,A20C,A21C] M superfamily Conus geographus (Geography cone) RDAATOOKKAKDRQAKOQRAAA(nh2)
P07485 GIIIA [A3C,A4C,A15C,A20C] M superfamily Conus geographus (Geography cone) RDAATOOKKCKDRQAKOQRACA(nh2)
P07482 GIIIA [A3C] M superfamily Conus geographus (Geography cone) RDACTOOKKCKDRQAKOQRCCA(nh2)
P07487 GIIIA [A4C,A10C,A20C,A21C] M superfamily Conus geographus (Geography cone) RDCATOOKKAKDRQCKOQRAAA(nh2)
P07483 GIIIA [A4C,C20A] M superfamily Conus geographus (Geography cone) RDCATOOKKCKDRQCKOQRACA(nh2)
P01570 GIIIA [R13A] synthetic construct RDCCTOOKKCKDAQCKOQRCCA(nh2)
P01566 GIIIB M superfamily Conus geographus (Geography cone) RDCCTOORKCKDRRCKOMKCCA(nh2)
P01744 GIIIC Conus geographus (Geography cone) RDCCTOOKKCKDRRCKOLKCCA(nh2)
P02845 Gla(2)-TxVI/A O2 superfamily Conus textile (Cloth-of-gold cone) SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02846 Gla(2)-TxVI/B O2 superfamily Conus textile (Cloth-of-gold cone) NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02692 Gla-MrIII T superfamily Conus marmoreus FCCRTQ(Gla)VCC(Gla)AIKN(nh2)
P04397 Gly-AnIB synthetic construct GGGCCSHPACAANNQD(sTy)C(nh2)
P02574 Gm5.2 T superfamily Conus gloriamaris VCCRPVQDCCS(nh2)
P02576 GmIXA P superfamily Conus gloriamaris SCNNSCQSHSDCASHCICTFRGCGAVN(nh2)
P01546 GVIA O1 superfamily Conus geographus (Geography cone) CKSOGSSCSOTSYNCCRSCNOYTKRCY(nh2)
P01780 GVIA [O10>K] synthetic construct CKSOGSSCSKTSYNCCRSCNOYTKRCY(nh2)
P05701 GVIA[C8U,C19U] synthetic construct CKSOGSSUSOTSYNCCRSUNOYTKRCY(nh2)
P02582 GVIIIA S superfamily Conus geographus (Geography cone) GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG
P08941 GVIIIB S superfamily Conus geographus (Geography cone) SGSTCTCFTSTNCQGSCECLSPPGCYCSNNGIRQRGCSCTC
P04646 Im1.8 A superfamily Conus imperialis LIAPFIRDYCCPRGPCMVWC(nh2)
P02584 Im5.1 T superfamily Conus imperialis SCCGKNPGCCPW(nh2)
P00010 ImI A superfamily Conus imperialis GCCSDPRCAWRC(nh2)
P04412 ImI [A9S] synthetic construct GCCSDPRCAWRC(nh2)
P03636 ImI [C2Agl,C8Agl] synthetic construct G(Agl)CSDPR(Agl)AWRC(nh2)
P08438 ImI [C2H,C8F] synthetic construct GHCSDPRFAWRC(nh2)
P02479 ImI [C2U,C3U,C8U,C12U] synthetic construct GUUSDPRUAWRU(nh2)
P02478 ImI [C2U,C8U] synthetic construct GUCSDPRUAWRC(nh2)
P04417 ImI [C3U,C12U] synthetic construct GCUSDPRCAWRU(nh2)
P04469 ImI [D5A] synthetic construct GCCSAPRCAWRC(nh2)
P04405 ImI [D5E] synthetic construct GCCSEPRCAWRC(nh2)
P04406 ImI [D5K] synthetic construct GCCSKPRCAWRC(nh2)
P00035 ImI [D5N] synthetic construct GCCSNPRCAWRC(nh2)
P04416 ImI [D5R,R7D] synthetic construct GCCSRPDCAWRC(nh2)
P04468 ImI [G1A] synthetic construct ACCSDPRCAWRC(nh2)
P04418 ImI [P60] synthetic construct GCCSDORCAWRC(nh2)
P04420 ImI [P6A(S)Pro] synthetic construct GCCSD(A(S)Pro)RCAWRC(nh2)
P02852 ImI [P6A] synthetic construct GCCSDARCAWRC(nh2)
P04419 ImI [P6APro] synthetic construct GCCSD(APro)RCAWRC(nh2)
P04427 ImI [P6benzPro] synthetic construct GCCSD(benz-Pro)RCAWRC(nh2)
P04422 ImI [P6betPro] synthetic construct GCCSD(bet-Pro)RCAWRC(nh2)
P04424 ImI [P6fluo(S)Pro] synthetic construct GCCSD(F-(S)-Pro)RCAWRC(nh2)
P04423 ImI [P6fluoPro] synthetic construct GCCSD(F-Pro)RCAWRC(nh2)
P04407 ImI [P6G] synthetic construct GCCSDGRCAWRC(nh2)
P04421 ImI [P6guaPro] synthetic construct GCCSD(Gua-Pro)RCAWRC(nh2)
P02851 ImI [P6K] synthetic construct GCCSDKRCAWRC(nh2)
P04428 ImI [P6naphPro] synthetic construct GCCSD(naph-Prot)RCAWRC(nh2)
P04429 ImI [P6phi(3S)Pro] synthetic construct GCCSD(phi3-Pro)RCAWRC(nh2)
P04430 ImI [P6phi(5R)Pro] synthetic construct GCCSD(phi5-Pro)RCAWRC(nh2)
P04426 ImI [P6phi(S)Pro] synthetic construct GCCSD(phi-(S)-Pro)RCAWRC(nh2)
P04425 ImI [P6phiPro] synthetic construct GCCSD(phi-Pro)RCAWRC(nh2)
P04473 ImI [P6S] synthetic construct GCCSDSRCAWRC(nh2)
P04408 ImI [P6V] synthetic construct GCCSDVRCAWRC(nh2)
P04472 ImI [R11A] synthetic construct GCCSDPRCAWAC(nh2)
P00033 ImI [R11E] synthetic construct GCCSDPRCAWEC(nh2)
P04415 ImI [R11Q] synthetic construct GCCSDPRCAWQC(nh2)
P04470 ImI [R7A] synthetic construct GCCSDPACAWRC(nh2)
P04411 ImI [R7E] synthetic construct GCCSDPECAWRC(nh2)
P04410 ImI [R7K] synthetic construct GCCSDPKCAWRC(nh2)
P00034 ImI [R7L] synthetic construct GCCSDPLCAWRC(nh2)
P04475 ImI [R7Nle] synthetic construct GCCSDP(Nle)CAWRC(nh2)
P04409 ImI [R7Q] synthetic construct GCCSDPQCAWRC(nh2)
P04403 ImI [S4A] synthetic construct GCCADPRCAWRC(nh2)
P04471 ImI [W10A] synthetic construct GCCSDPRCAARC(nh2)
P04413 ImI [W10F] synthetic construct GCCSDPRCAFRC(nh2)
P04414 ImI [W10T] synthetic construct GCCSDPRCATRC(nh2)
P04474 ImI [W10Y] synthetic construct GCCSDPRCAYRC(nh2)
P06677 Imi1 synthetic construct G(L-Dtn)ASDPRCAWRC(nh2)
P02586 ImII A superfamily Conus imperialis ACCSDRRCRWRC(nh2)
P03894 ImII [W10Y] synthetic construct ACCSDRRCRYRC(nh2)
P03893 ImII-iso synthetic construct ACCSDRRCRWRC(nh2)
P02617 ImIIA A superfamily Conus imperialis YCCHRGPCMVWC(nh2)
P02587 KIIIA M superfamily Conus kinoshitai CCNCSSKWCRDHSRCC(nh2)
P04490 KIIIA [D11A] synthetic construct CCNCSSKWCRAHSRCC(nh2)
P04309 KIIIA [H12A] synthetic construct CCNCSSKWCRDASRCC(nh2)
P04307 KIIIA [K7A] synthetic construct CCNCSSAWCRDHSRCC(nh2)
P04485 KIIIA [K7NLeu] synthetic construct CCNCSS(Nle)WCRDHSRCC(nh2)
P04482 KIIIA [N3A] synthetic construct CCACSSKWCRDHSRCC(nh2)
P04308 KIIIA [R10A] synthetic construct CCNCSSKWCADHSRCC(nh2)
P04489 KIIIA [R10A] synthetic construct CCNCSSKWCADHSRCC(nh2)
P04306 KIIIA [R14A] synthetic construct CCNCSSKWCRDHSACC(nh2)
P04491 KIIIA [S13A] synthetic construct CCNCSSKWCRDHARCC(nh2)
P04483 KIIIA [S5A] synthetic construct CCNCASKWCRDHSRCC(nh2)
P04484 KIIIA [S6A] synthetic construct CCNCSAKWCRDHSRCC(nh2)
P04486 KIIIA [W8A] synthetic construct CCNCSSKACRDHSRCC(nh2)
P04488 KIIIA [W8dTrp] synthetic construct CCNCSSKwCRDHSRCC(nh2)
P04323 KIIIA [W8E] synthetic construct CCNCSSKECRDHSRCC(nh2)
P04487 KIIIA [W8L] synthetic construct CCNCSSKLCRDHSRCC(nh2)
P04322 KIIIA [W8Q] synthetic construct CCNCSSKQCRDHSRCC(nh2)
P04321 KIIIA [W8R] synthetic construct CCNCSSKRCRDHSRCC(nh2)
P07433 KIIIA-P2 synthetic construct CCNCSSKWCRDHSRCC(nh2)
P03578 KIIIA[C1A,C9A] synthetic construct ACNCSSKWARDHSRCC(nh2)
P03579 KIIIA[C2A,C15A] synthetic construct CANCSSKWCRDHSRAC(nh2)
P03580 KIIIA[C4A,C16A] synthetic construct CCNASSKWCRDHSRCA(nh2)
P03581 KIIIA[Del1,S3/S4Aop,C9A] synthetic construct CNC(Aop)KWARDHARCC(nh2)
P07434 KIIIB Conus kinoshitai NGCCNCSSKWCRDHSRCC(nh2)
P07435 KIIIB-P1 synthetic construct NGCCNCSSKWCRDHSRCC(nh2)
P02659 Leu-contryphan-Tx O2 superfamily Conus textile (Cloth-of-gold cone) CVlYPWC(nh2)
P05283 Li1.12 Conus lividus GCCSHPVCSAMSPIC(nh2)
P02578 LiC32 T superfamily Conus lividus LWQNTWCCRDHLRCC(nh2)
P02579 LiC33 T superfamily Conus lividus ALCCYGYRFCCPIF(nh2)
P08784 Lo6.1 Conus longurionis DQCSYCGIYCCPPKFCTSAGCRSP(nh2)
P08783 Lo6.2 Conus longurionis SCLSSGALCGIDSNCCNGCNVPRNQCY(nh2)
P02496 Lp1.1 A superfamily Conus leopardus GCCARAACAGIHQELC(nh2)
P02505 Lp1.10 A superfamily Conus leopardus NDCCHNAPCRNNHPGIC(nh2)
P02660 Lp1.2 A superfamily Conus leopardus GCCSHPACSVNNPYFCG(nh2)
P02497 Lp1.4 A superfamily Conus leopardus GCCSHPACSGNHQELCD(nh2)
P02498 Lp1.5 A superfamily Conus leopardus DCCDDPACTVNNPGLCT(nh2)
P02499 Lp1.6a A superfamily Conus leopardus QFCCGHYDCDFIPNVC(nh2)
P06776 LsIA Conus limpusi SGCCSNPACRVNNPNIC(nh2)
P06779 LsIA [del1-2] synthetic construct CCSNPACRVNNPNIC(nh2)
P06778 LsIA [del1] synthetic construct GCCSNPACRVNNPNIC(nh2)
P08948 LsIA [N12D] synthetic construct SGCCSNPACRVDNPNIC(nh2)
P08949 LsIA [N12L] synthetic construct SGCCSNPACRVLNPNIC(nh2)
P08947 LsIA [N12Q] synthetic construct SGCCSNPACRVQNPNIC(nh2)
P08943 LsIA [N6H] synthetic construct SGCCSHPACRVNNPNIC(nh2)
P08945 LsIA [R10D] synthetic construct SGCCSNPACDVNNPNIC(nh2)
P08950 LsIA [R10F,N12L] synthetic construct SGCCSNPACFVLNPNIC(nh2)
P08946 LsIA [R10F] synthetic construct SGCCSNPACDVNNPNIC(nh2)
P08944 LsIA [R10M] synthetic construct SGCCSNPACMVNNPNIC(nh2)
P02666 Lt1.2 A superfamily Conus litteratus GCCARAACAGIHQELCG(nh2)
P07494 Lt1.3 [F15A] synthetic construct GCCSHPACSGNNPYAC(nh2)
P07480 Lt1.3 [globular] Conus litteratus GCCSHPACSGNNPYFC(nh2)
P07490 Lt1.3 [N11A] synthetic construct GCCSHPACSGANPYFC(nh2)
P07491 Lt1.3 [N12A] synthetic construct GCCSHPACSGNAPYFC(nh2)
P07492 Lt1.3 [P13A] synthetic construct GCCSHPACSGNNAYFC(nh2)
P07495 Lt1.3 [ribbon] Conus litteratus GCCSHPACSGNNPYFC(nh2)
P07489 Lt1.3 [S9A] synthetic construct GCCSHPACAGNNPYFC(nh2)
P07493 Lt1.3 [Y14A] synthetic construct GCCSHPACSGNNPAFC(nh2)
P02632 Lt5.1 T superfamily Conus litteratus ECCEDGWCCTAAPLT(nh2)
P02633 Lt5.2 T superfamily Conus litteratus PCCSIHDNSCC(nh2)
P02665 LtIA A superfamily Conus litteratus GCCARAACAGIHQELC(nh2)
P04479 LtIA [A4S,A6P] synthetic construct GCCSRPACAGIHQELC(nh2)
P04478 LtIA [A4S] synthetic construct GCCSRAACAGIHQELC(nh2)
P10394 LtIA-F synthetic construct (5-TAMRA)GCCARAACAGIHQELC(nh2)
P02588 LtXIVA L superfamily Conus litteratus MCPPLCKPSCTNC(nh2)
P04259 LtXIVA [K7A] synthetic construct MCPPLCAPSCTNC(nh2)
P06424 Lv1d A superfamily Conus lividus GCCSDPPCRHKHQDLC(nh2)
P05949 LvIA Conus lividus GCCSHPACNVDHPEIC(nh2)
P09963 LvIA[D11A] synthetic construct GCCSHPACNVAHPEIC(nh2)
P09964 LvIA[E14A] synthetic construct GCCSHPACNVDHPAIC(nh2)
P09957 LvIA[G1A] synthetic construct ACCSHPACNVDHPEIC(nh2)
P09970 LvIA[H12A] synthetic construct GCCSHPACNVDAPEIC(nh2)
P09959 LvIA[H5A] synthetic construct GCCSAPACNVDHPEIC(nh2)
P09965 LvIA[I15A] synthetic construct GCCSHPACNVDHPEAC(nh2)
P09961 LvIA[N9A] synthetic construct GCCSHPACAVDHPEIC(nh2)
P09972 LvIA[N9D] synthetic construct GCCSHPACDVDHPEIC(nh2)
P09966 LvIA[N9G] synthetic construct GCCSHPACGVDHPEIC(nh2)
P09969 LvIA[N9I] synthetic construct GCCSHPACIVDHPEIC(nh2)
P09968 LvIA[N9K] synthetic construct GCCSHPACKVDHPEIC(nh2)
P09967 LvIA[N9L] synthetic construct GCCSHPACLVDHPEIC(nh2)
P09971 LvIA[P13A] synthetic construct GCCSHPACNVDHAEIC(nh2)
P09960 LvIA[P6A] synthetic construct GCCSHAACNVDHPEIC(nh2)
P09958 LvIA[S4A] synthetic construct GCCAHPACNVDHPEIC(nh2)
P09962 LvIA[V10A] synthetic construct GCCSHPACNADHPEIC(nh2)
P10271 LvIB[del1,14] synthetic construct CCSNPPCAHEHC(nh2)
P10270 LvIB[del14] synthetic construct QCCSNPPCAHEHC(nh2)
P10269 LvIB[Q1G,del14] synthetic construct GCCSNPPCAHEHC(nh2)
P00014 M1A A superfamily Conus magus (Magus cone) DGRCCHPACAKHFNC(nh2)
P00016 M1B A superfamily Conus magus (Magus cone) NGRCCHPACARKYNC(nh2)
P02676 MaI51 O2 superfamily Conus marmoreus QCEDVWMPCTSNWECCSLDCEMYCTQI(nh2)
P00023 MI A superfamily Conus magus (Magus cone) GRCCHPACGKNYSC(nh2)
P04455 MI [H5A] synthetic construct GRCCAPACGKNYSC(nh2)
P04457 MI [K10A] synthetic construct GRCCHPACGANYSC(nh2)
P04458 MI [N11A] synthetic construct GRCCHPACGKAYSC(nh2)
P04456 MI [P6A] synthetic construct GRCCHAACGKNYSC(nh2)
P04454 MI [R2A] synthetic construct GACCHPACGKNYSC(nh2)
P04463 MI [S13A] synthetic construct GRCCHPACGKNYAC(nh2)
P04459 MI [Y12A] synthetic construct GRCCHPACGKNASC(nh2)
P04465 MI [Y12Dit] synthetic construct GRCCHPACGKN(Dit)SC(nh2)
P04461 MI [Y12H] synthetic construct GRCCHPACGKNHSC(nh2)
P04460 MI [Y12M] synthetic construct GRCCHPACGKNMSC(nh2)
P04462 MI [Y12W] synthetic construct GRCCHPACGKNWSC(nh2)
P02593 Mi5.2 T superfamily Conus miles CCPGNFACC(nh2)
P05866 MI[del1G] synthetic construct RCCHPACGKNYSC(nh2)
P05865 MIC Conus magus (Magus cone) CCHPACGKNYSC(nh2)
P00039 MII A superfamily Conus magus (Magus cone) GCCSNPVCHLEHSNLC(nh2)
P04392 MII [E11A,L15A] synthetic construct GCCSNPVCHLAHSNAC(nh2)
P03892 MII [E11A] synthetic construct GCCSNPVCHLAHSNLC(nh2)
P04319 MII [E11R] synthetic construct GCCSNPVCHLRHSNLC(nh2)
P04476 MII [G1A] synthetic construct ACCSNPVCHLEHSNLC(nh2)
P04386 MII [H12A] synthetic construct GCCSNPVCHLEASNLC(nh2)
P04390 MII [H9A,L15A] synthetic construct GCCSNPVCALEHSNAC(nh2)
P04379 MII [H9A] synthetic construct GCCSNPVCALEHSNLC(nh2)
P04391 MII [L10A,L15A] synthetic construct GCCSNPVCHAEHSNAC(nh2)
P04385 MII [L10A] synthetic construct GCCSNPVCHAEHSNLC(nh2)
P04380 MII [L15A] synthetic construct GCCSNPVCHLEHSNAC(nh2)
P04388 MII [N14A] synthetic construct GCCSNPVCHLEHSALC(nh2)
P04382 MII [N5A] synthetic construct GCCSAPVCHLEHSNLC(nh2)
P05527 MII [N5R,E11A,H12K] synthetic construct GCCSRPVCHLAKSNLC(nh2)
P04383 MII [P6A] synthetic construct GCCSNAVCHLEHSNLC(nh2)
P04387 MII [S13A] synthetic construct GCCSNPVCHLEHANLC(nh2)
P04477 MII [S4A,E11A,L15A] synthetic construct GCCANPVCHLAHSNAC(nh2)
P04389 MII [S4A,H9A] synthetic construct GCCANPVCALEHSNLC(nh2)
P04381 MII [S4A] synthetic construct GCCANPVCHLEHSNLC(nh2)
P04384 MII [V7A] synthetic construct GCCSNPACHLEHSNLC(nh2)
P01691 MIIIA Conus magus (Magus cone) ZGCCNVPNGCSGRWCRDHAQCC(nh2)
P09015 MilIA Conus milneedwardsi DMCCHPACMNHFNC(nh2)
P09019 MilIA[del1,M2R,M9G,N10K,H11K] synthetic construct RCCHPACGKKFNC(nh2)
P09018 MilIA[del1,M2R] synthetic construct RCCHPACMNHFNC(nh2)
P09016 MilIA[M9G,N10K] synthetic construct DMCCHPACGKHFNC(nh2)
P09020 MilIA[M9G] synthetic construct DMCCHPACGNHFNC(nh2)
P09017 MilIA[N10K] synthetic construct DMCCHPACMKHFNC(nh2)
P02527 MIVA A superfamily Conus magus (Magus cone) AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS
P06806 Ml6.5 O1 superfamily Conus miliaris CIATDDFCGLPGIGWNCCTGVCIIVCV(nh2)
P03638 Mn1.4 Conus monachus GRCCHPACAKYFSC(nh2)
P05511 Mr038 M superfamily Conus marmoreus N(Gla)FLTHTFS(Btr)HPTWCPWC(nh2)
P02491 Mr1.1 A superfamily Conus marmoreus GCCSHPACSVNNPDIC(nh2)
P02493 Mr1.2 A superfamily Conus marmoreus GCCSNPPCYANNQAYCN(nh2)
P02494 Mr1.3 A superfamily Conus marmoreus GCCSHPACRVHYPHVCY(nh2)
P04661 Mr1.7 A superfamily Conus marmoreus PECCTHPACHVSHPELC(nh2)
P09093 Mr1.7[del1,E2G,V11G,S12N] synthetic construct GCCTHPACHGNHPELC(nh2)
P09091 Mr1.7[E2A,S12N] synthetic construct PACCTHPACHVNHPELC(nh2)
P09085 Mr1.7[E2A] synthetic construct PACCTHPACHVSHPELC(nh2)
P09086 Mr1.7[H10A] synthetic construct PECCTHPACAVSHPELC(nh2)
P09087 Mr1.7[H13A] synthetic construct PECCTHPACHVSAPELC(nh2)
P09090 Mr1.7[H13N] synthetic construct PECCTHPACHVSNPELC(nh2)
P09083 Mr1.7[insN_R] synthetic construct RPECCTHPACHVSHPELC(nh2)
P09084 Mr1.7[P1A] synthetic construct AECCTHPACHVSHPELC(nh2)
P09089 Mr1.7[S12N] synthetic construct PECCTHPACHVNHPELC(nh2)
P09092 Mr1.7[V11G,S12N] synthetic construct PECCTHPACHGNHPELC(nh2)
P09088 Mr1.7[V11G] synthetic construct PECCTHPACHGSHPELC(nh2)
P06002 Mr1.8a A superfamily Conus marmoreus ECCTHPACHVSNPELC(nh2)
P05431 Mr1.9 M superfamily Conus marmoreus VCCPFGGCHELCTADD(nh2)
P05411 Mr14.6 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)ETCLLPQSYVLSVE
P05416 Mr3.11 M superfamily Conus marmoreus CCRIACNLKCNOCC(nh2)
P05422 Mr3.12 M superfamily Conus marmoreus LCCWKEWCHARCTCC(nh2)
P05424 Mr3.13 M superfamily Conus marmoreus LCCWIHWCHARCTCC(nh2)
P05433 Mr3.16 M superfamily Conus marmoreus VCCSFGSCDSLCQCCD(nh2)
P02688 Mr3.5 M superfamily Conus marmoreus MGCCPFPCKTSCTTLCC(nh2)
P05378 Mr6.12 O2 superfamily Conus marmoreus GCKATWMSCSSGWECCSMSCDMYC(nh2)
P05373 Mr6.28 O2 superfamily Conus marmoreus QCEDVWMPCTSNWECCSLDCERYCTQI(nh2)
P07576 MrIA [insN_(Hfe)] synthetic construct (HFE)NGVCCGYKLCHOC(nh2)
P08712 MrIA [insN_ILRGILR,del 6-13] synthetic construct ILRGILRNGVCC(nh2)
P07575 MrIA [insN_W] synthetic construct WNGVCCGYKLCHOC(nh2)
P07571 MrIA [N1(Abz)] synthetic construct (ABZ)GVCCGYKLCHOC(nh2)
P07560 MrIA [N1(Bhk)] synthetic construct (BHK)GVCCGYKLCHOC(nh2)
P07568 MrIA [N1(Cit)] synthetic construct (Cit)GVCCGYKLCHOC(nh2)
P07574 MrIA [N1(Dmf)] synthetic construct (DMF)GVCCGYKLCHOC(nh2)
P07563 MrIA [N1(Nle)] synthetic construct (Nle)GVCCGYKLCHOC(nh2)
P07565 MrIA [N1A] synthetic construct AGVCCGYKLCHOC(nh2)
P07570 MrIA [N1D] synthetic construct DGVCCGYKLCHOC(nh2)
P07567 MrIA [N1F] synthetic construct FGVCCGYKLCHOC(nh2)
P07564 MrIA [N1G] synthetic construct GGVCCGYKLCHOC(nh2)
P07566 MrIA [N1I] synthetic construct IGVCCGYKLCHOC(nh2)
P07561 MrIA [N1k] synthetic construct kGVCCGYKLCHOC(nh2)
P07572 MrIA [N1n] synthetic construct nGVCCGYKLCHOC(nh2)
P07569 MrIA [N1Q] synthetic construct QGVCCGYKLCHOC(nh2)
P07558 MrIA [N1R] synthetic construct RGVCCGYKLCHOC(nh2)
P07559 MrIA [N1r] synthetic construct rGVCCGYKLCHOC(nh2)
P07562 MrIA [N1S] synthetic construct SGVCCGYKLCHOC(nh2)
P07573 MrIA [N1T] synthetic construct TGVCCGYKLCHOC(nh2)
P07635 MrIA [N1Z, C10c] synthetic construct ZGVCCGYKLcHOC(nh2)
P07637 MrIA [N1Z, C13c] synthetic construct ZGVCCGYKLCHOc(nh2)
P07639 MrIA [N1Z, C4(Hcy), C5(Hcy), C10(Hcy), C13(Hcy)] synthetic construct ZGV(Hcy)(Hcy)GYKL(Hcy)HO(Hcy)(nh2)
P07636 MrIA [N1Z, C4c, C13c] synthetic construct ZGVcCGYKLCHOc(nh2)
P07633 MrIA [N1Z, C4c, C5c, C10c, C13c] synthetic construct ZGVccGYKLcHOc(nh2)
P07638 MrIA [N1Z, C4c] synthetic construct ZGVcCGYKLCHOC(nh2)
P07634 MrIA [N1Z, C5c, C10c] synthetic construct ZGVCcGYKLcHOC(nh2)
P07640 MrIA [N1Z, Y7(Mty), H11W] synthetic construct ZGVCCG(Mty)KLCWOC(nh2)
P07641 MrIA [N1Z, Y7(Mty), L9(Cha), H11W] synthetic construct ZGVCCG(Mty)K(Cha)CWOC(nh2)
P07621 MrIA [N1Z,H11(Bta)] synthetic construct ZGVCCGYKLC(BTA)OC(nh2)
P07616 MrIA [N1Z,H11(Fla)] synthetic construct ZGVCCGYKLC(FLA)OC(nh2)
P07620 MrIA [N1Z,H11(Nal)] synthetic construct ZGVCCGYKLC(Nal)OC(nh2)
P07617 MrIA [N1Z,H11(Pya)] synthetic construct ZGVCCGYKLC(PYA)OC(nh2)
P07625 MrIA [N1Z,H11E] synthetic construct ZGVCCGYKLCEOC(nh2)
P07615 MrIA [N1Z,H11F] synthetic construct ZGVCCGYKLCFOC(nh2)
P07622 MrIA [N1Z,H11h] synthetic construct ZGVCCGYKLChOC(nh2)
P07624 MrIA [N1Z,H11L] synthetic construct ZGVCCGYKLCLOC(nh2)
P07623 MrIA [N1Z,H11P] synthetic construct ZGVCCGYKLCPOC(nh2)
P07626 MrIA [N1Z,H11Q] synthetic construct ZGVCCGYKLCQOC(nh2)
P07614 MrIA [N1Z,H11R] synthetic construct ZGVCCGYKLCROC(nh2)
P07619 MrIA [N1Z,H11W] synthetic construct ZGVCCGYKLCWOC(nh2)
P07618 MrIA [N1Z,H11Y] synthetic construct ZGVCCGYKLCYOC(nh2)
P07603 MrIA [N1Z,K8(Cit)] synthetic construct ZGVCCGY(Cit)LCHOC(nh2)
P07596 MrIA [N1Z,K8(Hly)] synthetic construct ZGVCCGY(HLY)LCHOC(nh2)
P07602 MrIA [N1Z,K8(Nle)] synthetic construct ZGVCCGY(Nle)LCHOC(nh2)
P07595 MrIA [N1Z,K8(Orn)] synthetic construct ZGVCCGY(Orn)LCHOC(nh2)
P07601 MrIA [N1Z,K8E] synthetic construct ZGVCCGYELCHOC(nh2)
P07600 MrIA [N1Z,K8I] synthetic construct ZGVCCGYILCHOC(nh2)
P07594 MrIA [N1Z,K8k] synthetic construct ZGVCCGYkLCHOC(nh2)
P07599 MrIA [N1Z,K8L] synthetic construct ZGVCCGYLLCHOC(nh2)
P07598 MrIA [N1Z,K8Q] synthetic construct ZGVCCGYQLCHOC(nh2)
P07597 MrIA [N1Z,K8R] synthetic construct ZGVCCGYRLCHOC(nh2)
P07604 MrIA [N1Z,K8W] synthetic construct ZGVCCGYWLCHOC(nh2)
P07608 MrIA [N1Z,L9(Cha)] synthetic construct ZGVCCGYK(Chg)CHOC(nh2)
P07607 MrIA [N1Z,L9(Hle)] synthetic construct ZGVCCGYK(HLE)CHOC(nh2)
P07606 MrIA [N1Z,L9(Nle)] synthetic construct ZGVCCGYK(Nle)CHOC(nh2)
P07610 MrIA [N1Z,L9I] synthetic construct ZGVCCGYKICHOC(nh2)
P07611 MrIA [N1Z,L9P] synthetic construct ZGVCCGYKPCHOC(nh2)
P07609 MrIA [N1Z,L9Q] synthetic construct ZGVCCGYKQCHOC(nh2)
P07612 MrIA [N1Z,L9R] synthetic construct ZGVCCGYKRCHOC(nh2)
P07613 MrIA [N1Z,L9S] synthetic construct ZGVCCGYKSCHOC(nh2)
P07605 MrIA [N1Z,L9V] synthetic construct ZGVCCGYKVCHOC(nh2)
P07630 MrIA [N1Z,O12(Mey)] synthetic construct ZGVCCGYKLCH(Mty)C(nh2)
P07628 MrIA [N1Z,O12(Tic)] synthetic construct ZGVCCGYKLCH(Tic)C(nh2)
P07631 MrIA [N1Z,O12D] synthetic construct ZGVCCGYKLCHDC(nh2)
P07632 MrIA [N1Z,O12E] synthetic construct ZGVCCGYKLCHEC(nh2)
P07627 MrIA [N1Z,O12K] synthetic construct ZGVCCGYKLCHKC(nh2)
P07629 MrIA [N1Z,O12Y] synthetic construct ZGVCCGYKLCHYC(nh2)
P07582 MrIA [N1Z,Y7(Cha)] synthetic construct ZGVCCG(Cha)KLCHOC(nh2)
P07577 MrIA [N1Z,Y7(Dmk)] synthetic construct ZGVCCG(DMF)KLCHOC(nh2)
P07578 MrIA [N1Z,Y7(Dpa)] synthetic construct ZGVCCG(DPA)KLCHOC(nh2)
P07579 MrIA [N1Z,Y7(Hly)] synthetic construct ZGVCCG(HLY)KLCHOC(nh2)
P07581 MrIA [N1Z,Y7(Mty)] synthetic construct ZGVCCG(Mty)KLCHOC(nh2)
P07593 MrIA [N1Z,Y7(Thi)] synthetic construct ZGVCCG(THI)KLCHOC(nh2)
P07584 MrIA [N1Z,Y7E] synthetic construct ZGVCCGEKLCHOC(nh2)
P07580 MrIA [N1Z,Y7F] synthetic construct ZGVCCGFKLCHOC(nh2)
P07585 MrIA [N1Z,Y7I] synthetic construct ZGVCCGIKLCHOC(nh2)
P07586 MrIA [N1Z,Y7K] synthetic construct ZGVCCGKKLCHOC(nh2)
P07587 MrIA [N1Z,Y7L] synthetic construct ZGVCCGLKLCHOC(nh2)
P07588 MrIA [N1Z,Y7P] synthetic construct ZGVCCGPKLCHOC(nh2)
P07589 MrIA [N1Z,Y7Q] synthetic construct ZGVCCGQKLCHOC(nh2)
P07590 MrIA [N1Z,Y7R] synthetic construct ZGVCCGRKLCHOC(nh2)
P07591 MrIA [N1Z,Y7S] synthetic construct ZGVCCGSKLCHOC(nh2)
P07583 MrIA [N1Z,Y7W] synthetic construct ZGVCCGWKLCHOC(nh2)
P07592 MrIA [N1Z,Y7y] synthetic construct ZGVCCGyKLCHOC(nh2)
P06932 MrIA [N1Z] synthetic construct ZGVCCGYKLCHOC(nh2)
P04492 MrIA amidated synthetic construct NGVCCGYKLCHOC(nh2)
P08710 MrIA amidated [N1Z,del10-13] synthetic construct ZGVCCGYKL(nh2)
P08774 MrIA amidated [O12P] synthetic construct NGVCCGYKLCHPC(nh2)
P02849 MrIB amidated synthetic construct VGVCCGYKLCHOC(nh2)
P06003 MrIC A superfamily Conus marmoreus PECCTHPACHVSNPELC(nh2)
P02696 MrIIID M superfamily Conus marmoreus CCRLSCGLGCHOCC(nh2)
P02697 MrIIIE M superfamily Conus marmoreus VCCPFGGCHELCYCCD(nh2)
P01485 MrIIIF M superfamily Conus marmoreus VCCPFGGCHELCLCCD(nh2)
P02698 MrIIIG M superfamily Conus marmoreus DCCOLPACPFGCNOCC(nh2)
P01624 MVIA O1 superfamily Conus magus (Magus cone) DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2)
P01623 MVIB O1 superfamily Conus magus (Magus cone) EACYNAGSFCGIHOGLCCSEFCILWCITFVDS(nh2)
P01386 MVIIA O1 superfamily Conus magus (Magus cone) CKGKGAKCSRLMYDCCTGSCRSGKC(nh2)
P06889 MVIIA[D14N] synthetic construct CKGKGAKCSRLMYNCCTGSCRSGKC(nh2)
P06887 MVIIA[G2A,K3A,A5K,K6P] synthetic construct CKAAGKPCSRLMYDCCTGSCRSGKC(nh2)
P04240 MVIIA[K2A] synthetic construct CAGKGAKCSRLMYDCCTGSCRSGKC(nh2)
P06888 MVIIA[L11I,M12A,D14N] synthetic construct CKGKGAKCSRIAYNCCTGSCRSGKC(nh2)
P06891 MVIIA[L11I] synthetic construct CKGKGAKCSRIMYDCCTGSCRSGKC(nh2)
P01661 MVIIA[R10K] synthetic construct CKGKGAKCSKLMYDCCTGSCRSGKC(nh2)
P04239 MVIIA[Y13A] synthetic construct CKGKGAKCSRLMADCCTGSCRSGKC(nh2)
P01638 MVIIB O1 superfamily Conus magus (Magus cone) CKGKGASCHRTSYDCCTGSCNRGKC(nh2)
P01484 MVIIC Conus magus (Magus cone) CKGKGAPCRKTMYDCCSGSCGRRGKC(nh2)
P01658 MVIIC analog synthetic construct CKGKGAPCRKTMYDCCKGRCGRRGRC(nh2)
P02675 MVIID O1 superfamily Conus magus (Magus cone) CQGRGASCRKTMYNCCSGSCNRGRC(nh2)
P01397 OIVA A superfamily Conus obscurus CCGVONAACHOCVCKNTC(nh2)
P04446 OIVA [H10P] synthetic construct CCGVONAACPOCVCKNTC(nh2)
P04447 OIVA [K15N] synthetic construct CCGVONAACHOCVCNNTC(nh2)
P01688 OIVB A superfamily Conus obscurus CCGVONAACPOCVCNKTCG(nh2)
P00006 OmIA A superfamily Conus omaria GCCSHPACNVNNPHICG(nh2)
P04680 P3.9 M superfamily Conus purpurascens HPPCCMYGRCRRYPGCSSASCCQ(nh2)
P05219 Pc16a Conus pictus SCSCKRNFLCC(nh2)
P05862 Pc16c Conus pictus SCSCQKHFSCCD(nh2)
P02608 PeIA A superfamily Conus pergrandis GCCSHPACSVNHPELC(nh2)
P09949 PeIA[A7V, S9H, N11R] synthetic construct GCCSHPVCHVRHPELC(nh2)
P09950 PeIA[A7V, S9N, N11R, L15I] synthetic construct GCCSHPVCNVRHPEIC(nh2)
P09951 PeIA[A7V, S9N, N11R] synthetic construct GCCSHPVCNVRHPELC(nh2)
P09952 PeIA[A7V, S9R, V10A, N11R, E14A] synthetic construct GCCSHPVCRARHPALC(nh2)
P09953 PeIA[A7V, S9R, V10A, N11R, P13R, E14A] synthetic construct GCCSHPVCRARHRALC(nh2)
P06804 PeIA[A7V,S9H,V10A,N11R,E14A] synthetic construct GCCSHPVCHARHPALC(nh2)
P06802 PeIA[A7V,S9H,V10A,N11R] synthetic construct GCCSHPVCHARHPELC(nh2)
P06793 PeIA[A7V] synthetic construct GCCSHPVCSVNHPELC(nh2)
P08993 PeIA[E14(Aad)] synthetic construct GCCSHPACSVNHP(Aad)LC(nh2)
P08973 PeIA[E14(Asu)] synthetic construct GCCSHPACSVNHP(Asu)LC(nh2)
P08972 PeIA[E14(Gla)] synthetic construct GCCSHPACSVNHP(Gla)LC(nh2)
P06790 PeIA[E14A] synthetic construct GCCSHPACSVNHPALC(nh2)
P08974 PeIA[E14D] synthetic construct GCCSHPACSVNHPDLC(nh2)
P05854 PeIA[E14N] synthetic construct GCCSHPACSVNHPNLC(nh2)
P08975 PeIA[E14Q] synthetic construct GCCSHPACSVNHPQLC(nh2)
P08976 PeIA[E14R] synthetic construct GCCSHPACSVNHPRLC(nh2)
P06787 PeIA[H12A] synthetic construct GCCSHPACSVNAPELC(nh2)
P06782 PeIA[H5A] synthetic construct GCCSAPACSVNHPELC(nh2)
P06792 PeIA[H5N] synthetic construct GCCSNPACSVNHPELC(nh2)
P08979 PeIA[L15(Nle)] synthetic construct GCCSHPACSVNHPE(Nle)C(nh2)
P06791 PeIA[L15A] synthetic construct GCCSHPACSVNHPEAC(nh2)
P08978 PeIA[L15I] synthetic construct GCCSHPACSVNHPEIC(nh2)
P08977 PeIA[L15R] synthetic construct GCCSHPACSVNHPERC(nh2)
P08980 PeIA[L15V] synthetic construct GCCSHPACSVNHPEVC(nh2)
P08969 PeIA[N11(Aad)] synthetic construct GCCSHPACSV(Aad)HPELC(nh2)
P08970 PeIA[N11(Api)] synthetic construct GCCSHPACSV(Api)HPELC(nh2)
P08971 PeIA[N11(Asu)] synthetic construct GCCSHPACSV(Asu)HPELC(nh2)
P06786 PeIA[N11A] synthetic construct GCCSHPACSVAHPELC(nh2)
P08968 PeIA[N11D] synthetic construct GCCSHPACSVDHPELC(nh2)
P06797 PeIA[N11E] synthetic construct GCCSHPACSVEHPELC(nh2)
P06799 PeIA[N11K] synthetic construct GCCSHPACSVKHPELC(nh2)
P06798 PeIA[N11R] synthetic construct GCCSHPACSVRHPELC(nh2)
P06788 PeIA[P13A] synthetic construct GCCSHPACSVNHAELC(nh2)
P06789 PeIA[P13O] synthetic construct GCCSHPACSVNHOELC(nh2)
P08410 PeIA[P13Q] synthetic construct GCCSHPACSVNHQELC(nh2)
P08411 PeIA[P13R] synthetic construct GCCSHPACSVNHRELC(nh2)
P06800 PeIA[P13S] synthetic construct GCCSHPACSVNHSELC(nh2)
P06783 PeIA[P6A] synthetic construct GCCSHAACSVNHPELC(nh2)
P06784 PeIA[P6O] synthetic construct GCCSHOACSVNHPELC(nh2)
P06781 PeIA[S4A] synthetic construct GCCAHPACSVNHPELC(nh2)
P06785 PeIA[S9A] synthetic construct GCCSHPACAVNHPELC(nh2)
P09044 PeIA[S9D] synthetic construct GCCSHPACDVNHPELC(nh2)
P08989 PeIA[S9H,V10(Nle),N11(Api),L15I] synthetic construct GCCSHPACH(Nle)(Api)HPEIC(nh2)
P08986 PeIA[S9H,V10(Nle),N11(Api)] synthetic construct GCCSHPACH(Nle)(Api)HPELC(nh2)
P06803 PeIA[S9H,V10A,N11R,E14A] synthetic construct GCCSHPACHARHPALC(nh2)
P06801 PeIA[S9H,V10A,N11R] synthetic construct GCCSHPACHARHPELC(nh2)
P09045 PeIA[S9H,V10I,N11(Api),L15(Nle)] synthetic construct GCCSHPACHI(Api)HPE(Nle)C(nh2)
P08987 PeIA[S9H,V10L,L15I] synthetic construct GCCSHPACHLNHPEIC(nh2)
P08984 PeIA[S9H,V10L,N11(Aad)] synthetic construct GCCSHPACHL(Aad)HPELC(nh2)
P08988 PeIA[S9H,V10L,N11(Api),L15I] synthetic construct GCCSHPACHL(Api)HPEIC(nh2)
P08990 PeIA[S9H,V10L,N11(Api)] synthetic construct GCCSHPACHL(Api)HPELC(nh2)
P08985 PeIA[S9H,V10L,N11(Asu)] synthetic construct GCCSHPACHL(Asu)HPELC(nh2)
P08982 PeIA[S9H,V10L,N11D] synthetic construct GCCSHPACHLDHPELC(nh2)
P08983 PeIA[S9H,V10L,N11E] synthetic construct GCCSHPACHLEHPELC(nh2)
P08981 PeIA[S9H,V10L] synthetic construct GCCSHPACHLNHPELC(nh2)
P05852 PeIA[S9H] synthetic construct GCCSHPACHVNHPELC(nh2)
P08962 PeIA[S9N] synthetic construct GCCSHPACNVNHPELC(nh2)
P09046 PeIA[S9R,V10I,N11(Api),L15(Nle)] synthetic construct GCCSHPACRI(Api)HPE(Nle)C(nh2)
P06794 PeIA[S9R] synthetic construct GCCSHPACRVNHPELC(nh2)
P08964 PeIA[S9T] synthetic construct GCCSHPACTVNHPELC(nh2)
P08963 PeIA[S9Y] synthetic construct GCCSHPACYVNHPELC(nh2)
P08966 PeIA[V10(Nle)] synthetic construct GCCSHPACS(Nle)NHPELC(nh2)
P05853 PeIA[V10A] synthetic construct GCCSHPACSANHPELC(nh2)
P09948 PeIA[V10D] synthetic construct GCCSHPACSDNHPELC(nh2)
P08965 PeIA[V10I] synthetic construct GCCSHPACSINHPELC(nh2)
P06796 PeIA[V10L] synthetic construct GCCSHPACSLNHPELC(nh2)
P06795 PeIA[V10R] synthetic construct GCCSHPACSRNHPELC(nh2)
P08967 PeIA[V10T] synthetic construct GCCSHPACSTNHPELC(nh2)
P00595 PIA A superfamily Conus purpurascens RDPCCSNPVCTVHNPQIC(nh2)
P04310 PIA Δ1 synthetic construct DPCCSNPVCTVHNPQIC(nh2)
P04311 PIA Δ1-2 synthetic construct PCCSNPVCTVHNPQIC(nh2)
P04312 PIA Δ1-3 synthetic construct CCSNPVCTVHNPQIC(nh2)
P04313 PIA [R1ADMA] synthetic construct (ADMA)DPCCSNPVCTVHNPQIC(nh2)
P04316 PIA [R1E] synthetic construct EDPCCSNPVCTVHNPQIC(nh2)
P04314 PIA [R1K] synthetic construct KDPCCSNPVCTVHNPQIC(nh2)
P04315 PIA [R1L] synthetic construct LDPCCSNPVCTVHNPQIC(nh2)
P00038 PIB A superfamily Conus purpurascens ZSOGCCWNPACVKNRC(nh2)
P02228 PIIIA M superfamily Conus purpurascens ZRLCCGFOKSCRSRQCKOHRCC(nh2)
P04296 PIIIA [G6K] synthetic construct ZRLCCKFOKSCRSRQCKOHRCC(nh2)
P04300 PIIIA [K17A] synthetic construct ZRLCCAFOKSCRSRQCAOHRCC(nh2)
P04301 PIIIA [K17Q] synthetic construct ZRLCCAFOKSCRSRQCQOHRCC(nh2)
P04294 PIIIA [K17R] synthetic construct ZRLCCGFOKSCRSRQCROHRCC(nh2)
P04297 PIIIA [R12A] synthetic construct ZRLCCAFOKSCASRQCKOHRCC(nh2)
P04293 PIIIA [R12K] synthetic construct ZRLCCGFOKSCKSRQCKOHRCC(nh2)
P04298 PIIIA [R12Q] synthetic construct ZRLCCAFOKSCQSRQCKOHRCC(nh2)
P04290 PIIIA [R14A] synthetic construct ZRLCCGFOKSCRSAQCKOHRCC(nh2)
P04292 PIIIA [R14K] synthetic construct ZRLCCGFOKSCRSKQCKOHRCC(nh2)
P04291 PIIIA [R14Q] synthetic construct ZRLCCGFOKSCRSQQCKOHRCC(nh2)
P04302 PIIIA [R20A] synthetic construct ZRLCCAFOKSCRSRQCKOHACC(nh2)
P04295 PIIIA [R2A] synthetic construct ZALCCGFOKSCRSRQCKOHRCC(nh2)
P04299 PIIIA [S13D] synthetic construct ZRLCCAFOKSCRDRQCKOHRCC(nh2)
P01611 PIIIE M superfamily Conus purpurascens HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P04448 PIIIE [K9S] synthetic construct HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P04449 PIIIE [R12O,Y13F] synthetic construct HOOCCLYGKCROFOGCSSASCCQR(nh2)
P04450 PIIIE [S17Y,S18N,S20L] synthetic construct HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P01594 PIIIF M superfamily Conus purpurascens GOOCCLYGSCROFOGCYNALCCRK(nh2)
P04452 PIIIF [O12R,F13Y] synthetic construct GOOCCLYGSCRRYOGCYNALCCRK(nh2)
P04451 PIIIF [S9K] synthetic construct GOOCCLYGSCROFOGCYNALCCRK(nh2)
P04453 PIIIF [Y17S,N18S,L20S] synthetic construct GOOCCLYGSCROFOGCSSASCCRK(nh2)
P01449 PIVA A superfamily Conus purpurascens GCCGSYONAACHOCSCKDROSYCGQ(nh2)
P01612 PIVA [Hyp7P,Hyp13P] synthetic construct GCCGSYPNAACHPCSCKDROSYCGQ(nh2)
P01670 PIVE Conus purpurascens DCCGVKLEMCHPCLCDNSCKNYGK(nh2)
P01669 PIVF Conus purpurascens DCCGVKLEMCHPCLCDNSCKKSGK(nh2)
P02605 Pl14.1 J superfamily Conus planorbis GPGSAICNMACRLGQGHMYPFCNCN(nh2)
P02606 Pl14.2 J superfamily Conus planorbis GPGSAICNMACRLEHGHLYPFCHCR(nh2)
P02607 Pl14.3 J superfamily Conus planorbis GPGSAICNMACRLEHGHLYPFCNCD(nh2)
P01539 PlXIVA J superfamily Conus planorbis FPRPRICNLACRAGIGHKYPFCHCR(nh2)
P02700 Pn-0111 T superfamily Conus pennaceus MCCLGTSGCCPW(nh2)
P02701 Pn-014 T superfamily Conus pennaceus YDCCKTFECCHW(nh2)
P02702 Pn-B01121 T superfamily Conus pennaceus YCCVYDYSCCLSW(nh2)
P02704 Pn-B01411 T superfamily Conus pennaceus CCYETPGCCVI(nh2)
P02706 Pn-B02 T superfamily Conus pennaceus ECCSDGWCCPA(nh2)
P00075 Pni1 synthetic construct GCCSLPPCAANNPDYC(nh2)
P00051 PnIA A superfamily Conus pennaceus GCCSLPPCAANNPD(sTy)C(nh2)
P00505 PnIA [A10L,D14K,sTy15Y] synthetic construct GCCSLPPCALNNPKYC(nh2)
P04375 PnIA [A10L,sTy15Y] synthetic construct GCCSLPPCALNNPDYC(nh2)
P07528 PnIA [A9R,A10L] synthetic construct GCCSLPPCRLNNPDYC(nh2)
P07527 PnIA [A9R] synthetic construct GCCSLPPCRANNPDYC(nh2)
P04444 PnIA [L5R,A10L,sTy15Y] synthetic construct GCCSRPPCALNNPDYC(nh2)
P07529 PnIA [L5R,A9R,A10L,D14R] synthetic construct GCCSRPPCRLNNPRYC(nh2)
P04376 PnIA [N11S,sTy15Y] synthetic construct GCCSLPPCAASNPDYC(nh2)
P04433 PnIA [P6A(S)Pro] synthetic construct GCCSL(A(S)Pro)PCAANNPD(sTy)C(nh2)
P04432 PnIA [P6APro] synthetic construct GCCSL(APro)PCAANNPD(sTy)C(nh2)
P04440 PnIA [P6benzPro] synthetic construct GCCSL(benz-Pro)PCAANNPD(sTy)C(nh2)
P04435 PnIA [P6betPro] synthetic construct GCCSL(bet-Pro)PCAANNPD(sTy)C(nh2)
P04437 PnIA [P6fluo(S)Pro] synthetic construct GCCSL(F-(S)-Pro)PCAANNPD(sTy)C(nh2)
P04436 PnIA [P6fluoPro] synthetic construct GCCSL(F-Pro)PCAANNPD(sTy)C(nh2)
P04434 PnIA [P6guaPro] synthetic construct GCCSL(Gua-Pro)PCAANNPD(sTy)C(nh2)
P04441 PnIA [P6naphPro] synthetic construct GCCSL(naph-Prot)PCAANNPD(sTy)C(nh2)
P04431 PnIA [P6O] synthetic construct GCCSLOPCAANNPD(sTy)C(nh2)
P04442 PnIA [P6phi(3S)Pro] synthetic construct GCCSL(phi3-Pro)PCAANNPD(sTy)C(nh2)
P04443 PnIA [P6phi(5R)Pro] synthetic construct GCCSL(phi5-Pro)PCAANNPD(sTy)C(nh2)
P04439 PnIA [P6phi(S)Pro] synthetic construct GCCSL(phi-(S)-Pro)PCAANNPD(sTy)C(nh2)
P04438 PnIA [P6phiPro] synthetic construct GCCSL(phi-Pro)PCAANNPD(sTy)C(nh2)
P04377 PnIA [sTy15Y] synthetic construct GCCSLPPCAANNPDYC(nh2)
P10272 PnIA[A10L] synthetic construct GCCSLPPCALNNPDYC(nh2)
P00099 PnIB A superfamily Conus pennaceus GCCSLPPCALSNPD(sTy)C(nh2)
P04378 PnIB [sTy15Y] synthetic construct GCCSLPPCALSNPDYC(nh2)
P04211 Pr3b Conus parius ERVCCGYOMSCKSRACKOSYCC(nh2)
P02832 PrIIIE M superfamily Conus parius AARCCTYHGSCLKEKCRRKYCC(nh2)
P02859 PrXA C superfamily Conus parius TYGIYDAKPOFSCAGLRGGCVLPONLROKFKE(nh2)
P02519 Pu1.1 A superfamily Conus pulicarius QNCCNVPGCWAKYKHLC(nh2)
P02520 Pu1.2 A superfamily Conus pulicarius GGCCSYPPCIANNPLC(nh2)
P07436 Pu1.2[C3S,C9S] synthetic construct GGSCSYPPSIANNPLC(nh2)
P07438 Pu1.2[del1-8] synthetic construct CIANNPLC(nh2)
P07437 Pu1.2[del10-16,C4S] synthetic construct GGCSSYPPC(nh2)
P02790 Pu5.1 T superfamily Conus pulicarius SCCPSPTSCCPW(nh2)
P02792 Pu5.2 T superfamily Conus pulicarius GCCEDKTCCFI(nh2)
P02796 Pu5.4 T superfamily Conus pulicarius SCCPEEITCCPW(nh2)
P02596 PVA T superfamily Conus purpurascens GCCPKQMRCCTL(nh2)
P02595 PVIA O1 superfamily Conus purpurascens EACYAOGTFCGIKOGLCCSEFCLPGVCFG(nh2)
P01356 PVIIA O1 superfamily Conus purpurascens CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04364 PVIIA [D13A] synthetic construct CRIONQKCFQHLADCCSRKCNRFNKCV(nh2)
P04369 PVIIA [F23A] synthetic construct CRIONQKCFQHLDDCCSRKCNRANKCV(nh2)
P04359 PVIIA [F9A] synthetic construct CRIONQKCAQHLDDCCSRKCNRFNKCV(nh2)
P04360 PVIIA [F9M] synthetic construct CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04361 PVIIA [F9Y] synthetic construct CRIONQKCYQHLDDCCSRKCNRFNKCV(nh2)
P04363 PVIIA [H11A] synthetic construct CRIONQKCFQALDDCCSRKCNRFNKCV(nh2)
P04355 PVIIA [I3A] synthetic construct CRAONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04367 PVIIA [K19A] synthetic construct CRIONQKCFQHLDDCCSRACNRFNKCV(nh2)
P04371 PVIIA [K25A] synthetic construct CRIONQKCFQHLDDCCSRKCNRFNACV(nh2)
P04357 PVIIA [K7A] synthetic construct CRIONQACFQHLDDCCSRKCNRFNKCV(nh2)
P04358 PVIIA [K7R] synthetic construct CRIONQRCFQHLDDCCSRKCNRFNKCV(nh2)
P04370 PVIIA [N24A] synthetic construct CRIONQKCFQHLDDCCSRKCNRFAKCV(nh2)
P04362 PVIIA [Q10A] synthetic construct CRIONQKCFAHLDDCCSRKCNRFNKCV(nh2)
P04356 PVIIA [Q6A] synthetic construct CRIONAKCFQHLDDCCSRKCNRFNKCV(nh2)
P04366 PVIIA [R18A] synthetic construct CRIONQKCFQHLDDCCSAKCNRFNKCV(nh2)
P04368 PVIIA [R22A] synthetic construct CRIONQKCFQHLDDCCSRKCNAFNKCV(nh2)
P04352 PVIIA [R2A] synthetic construct CAIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04354 PVIIA [R2K] synthetic construct CKIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04353 PVIIA [R2Q] synthetic construct CQIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04365 PVIIA [S17A] synthetic construct CRIONQKCFQHLDDCCARKCNRFNKCV(nh2)
P02511 Qc1.2 A superfamily Conus quercinus QCCANPPCKHVNC(nh2)
P02513 Qc1.4 A superfamily Conus quercinus QGCCSDPACAVSNPDIC(nh2)
P02514 Qc1.4a A superfamily Conus quercinus DGCCSNPSCSVNNPDIC(nh2)
P02515 Qc1.4b A superfamily Conus quercinus DGCCPNPSCSVNNPDIC(nh2)
P02516 Qc1.5 A superfamily Conus quercinus GCCSNPACSVNHPELC(nh2)
P02517 Qc1.6 A superfamily Conus quercinus GCCSNPTCAGNNGNIC(nh2)
P01514 QcIIIA M superfamily Conus quercinus CCSQDCLVCIOCCPN(nh2)
P01513 QcIIIB M superfamily Conus quercinus CCSRHCWVCIOCCPN(nh2)
P04317 RDP-MII synthetic construct RDPGCCSNPVCHLEHSNLC(nh2)
P04320 RDP-MII [E11R] synthetic construct RDPGCCSNPVCHLRHSNLC(nh2)
P04318 RDP-MII [R1ADMA] synthetic construct (ADMA)DPGCCSNPVCHLEHSNLC(nh2)
P01493 Reg12e M superfamily Conus regius KCCMRPICTCOCCIGP(nh2)
P00028 Reg1b/Reg1c A superfamily Conus regius GCCSDORCKHQC(nh2)
P00029 Reg1d A superfamily Conus regius GCCSDPRCKHEC(nh2)
P00031 Reg1f A superfamily Conus regius DYCCRROOCTLIC(nh2)
P08536 reg3f M superfamily Conus regius GCCPFPACTTHIICRCC(nh2)
P08560 reg3g Conus regius CCMALCSRYHCLPCC(nh2)
P08538 reg3h Conus regius GCCSOWNCIQLRACOCCON(nh2)
P08534 reg3k M superfamily Conus regius KCCMRPICMCOCCIGP(nh2)
P00032 RegIIA A superfamily Conus regius GCCSHPACNVNNPHIC(nh2)
P09055 RegIIA[H14A] synthetic construct GCCSHPACNVNNPAIC(nh2)
P08487 RegIIA[H5D] synthetic construct GCCSDPACNVNNPHIC(nh2)
P09056 RegIIA[I15A] synthetic construct GCCSHPACNVNNPHAC(nh2)
P09057 RegIIA[N11A,N12A] synthetic construct GCCSHPACNVAAPHIC(nh2)
P09052 RegIIA[N11A] synthetic construct GCCSHPACNVANPHIC(nh2)
P09176 RegIIA[N11H] synthetic construct GCCSHPACNVHNPHIC(nh2)
P09177 RegIIA[N11R] synthetic construct GCCSHPACNVRNPHIC(nh2)
P09178 RegIIA[N11Y] synthetic construct GCCSHPACNVYNPHIC(nh2)
P09053 RegIIA[N12A] synthetic construct GCCSHPACNVNAPHIC(nh2)
P09050 RegIIA[N9A] synthetic construct GCCSHPACAVNNPHIC(nh2)
P09170 RegIIA[N9F] synthetic construct GCCSHPACFVNNPHIC(nh2)
P09173 RegIIA[N9R] synthetic construct GCCSHPACRVNNPHIC(nh2)
P09171 RegIIA[N9W] synthetic construct GCCSHPACWVNNPHIC(nh2)
P09172 RegIIA[N9Y] synthetic construct GCCSHPACYVNNPHIC(nh2)
P09054 RegIIA[P13A] synthetic construct GCCSHPACNVNNAHIC(nh2)
P09051 RegIIA[V10A] synthetic construct GCCSHPACNANNPHIC(nh2)
P09174 RegIIA[V10F] synthetic construct GCCSHPACNFNNPHIC(nh2)
P09175 RegIIA[V10Y] synthetic construct GCCSHPACNYNNPHIC(nh2)
P07466 RgIA [del13] synthetic construct GCCSDPRCRYRC(nh2)
P00030 RgIA [P6O,del13] A superfamily Conus regius GCCSDORCRYRC(nh2)
P09747 RgIA [R13COOH-Phe] amidated synthetic construct GCCSDPRCRYRC(COOH-Phe)(nh2)
P09745 RgIA [R13F] amidated synthetic construct GCCSDPRCRYRCF(nh2)
P09746 RgIA [R13Y] amidated synthetic construct GCCSDPRCRYRCR(nh2)
P07656 RgIA [R7r,R9r,R11r,del13] amidated synthetic construct GCCSDPrCrYrC(nh2)
P02591 RIIIK M superfamily Conus radiatus LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04337 RIIIK [K18A] synthetic construct LOSCCSLNLRLCOVOACARNOCCT(nh2)
P04339 RIIIK [K18R, R19K] synthetic construct LOSCCSLNLRLCOVOACRKNOCCT(nh2)
P04333 RIIIK [L11A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04325 RIIIK [L1A] synthetic construct AOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04344 RIIIK [L1E] synthetic construct EOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04350 RIIIK [L1F] synthetic construct FOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04345 RIIIK [L1H] synthetic construct HOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04346 RIIIK [L1I] synthetic construct IOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04348 RIIIK [L1K] synthetic construct KOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04347 RIIIK [L1M] synthetic construct MOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04349 RIIIK [L1R] synthetic construct ROSCCSLNLRLCOVOACKRNOCCT(nh2)
P04351 RIIIK [L1Y] synthetic construct YOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04329 RIIIK [L7A] synthetic construct LOSCCSANLRLCOVOACKRNOCCT(nh2)
P04331 RIIIK [L9A] synthetic construct LOSCCSLNARLCOVOACKRNOCCT(nh2)
P04340 RIIIK [N20A] synthetic construct LOSCCSLNLRLCOVOACKRAOCCT(nh2)
P04330 RIIIK [N8A] synthetic construct LOSCCSLALRLCOVOACKRNOCCT(nh2)
P04334 RIIIK [O13A] synthetic construct LOSCCSLNLRLCAVOACKRNOCCT(nh2)
P04336 RIIIK [O15A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04341 RIIIK [O21A] synthetic construct LOSCCSLNLRLCOVOACKRNACCT(nh2)
P04326 RIIIK [O2A] synthetic construct LASCCSLNLRLCOVOACKRNOCCT(nh2)
P04332 RIIIK [R10A] synthetic construct LOSCCSLNLALCOVOACKRNOCCT(nh2)
P04338 RIIIK [R19A] synthetic construct LOSCCSLNLRLCOVOACKANOCCT(nh2)
P04327 RIIIK [S3A] synthetic construct LOACCSLNLRLCOVOACKRNOCCT(nh2)
P04328 RIIIK [S6A] synthetic construct LOSCCALNLRLCOVOACKRNOCCT(nh2)
P04342 RIIIK [T24A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCA(nh2)
P04335 RIIIK [V14A] synthetic construct LOSCCSLNLRLCOAOACKRNOCCT(nh2)
P04238 RIIIKΔ9 synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P08605 Rt27.1 G2 superfamily Conus rattus RDCQRGCHGCSNVPNGCCCGNLVCQNEQRCVPKE(nh2)
P01478 RXIE I1 superfamily Conus radiatus ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC
P02522 S1.1 A superfamily Conus striatus (Striated cone) NGCCRNPACESHRC(nh2)
P02482 Scratcher peptide Conus geographus (Geography cone) KFLSGGFK(Gla)IVCHRYCAKGIAKEFCNCPD(nh2)
P00001 SI A superfamily Conus striatus (Striated cone) ICCNPACGPKYSC(nh2)
P04400 SI [K10H] synthetic construct ICCNPACGPHYSC(nh2)
P04401 SI [K10N] synthetic construct ICCNPACGPNYSC(nh2)
P04399 SI [P9K] synthetic construct ICCNPACGKKYSC(nh2)
P00025 SIA A superfamily Conus striatus (Striated cone) YCCHPACGKNFDC(nh2)
P02707 SIIIA M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCRDHARCC(nh2)
P05703 SIIIA[C3U,C13U] synthetic construct ZNUCNGGCSSKWURDHARCC(nh2)
P05702 SIIIA[C4U,C19U] synthetic construct ZNCUNGGCSSKWCRDHARUC(nh2)
P05704 SIIIA[C8U,C20U] synthetic construct ZNCCNGGUSSKWCRDHARCU(nh2)
P07461 SIIIA[del1,D15A,H16D] synthetic construct NCCNGGCSSKWCRADARCC(nh2)
P07460 SIIIA[del1,D15A,H16R] synthetic construct NCCNGGCSSKACRARARCC(nh2)
P07459 SIIIA[del1,D15A,H16Y] synthetic construct NCCNGGCSSKWCRAYARCC(nh2)
P05814 SIIIA[del1,D15A,insC_A] synthetic construct NCCNGGCSSKWCRAHARCCA(nh2)
P05815 SIIIA[del1,D15A,insC_AA] synthetic construct NCCNGGCSSKWCRAHARCCAA(nh2)
P05819 SIIIA[del1,D15A,insC_AD] synthetic construct NCCNGGCSSKWCRAHARCCAD(nh2)
P05817 SIIIA[del1,D15A,insC_AK] synthetic construct NCCNGGCSSKWCRAHARCCAK(nh2)
P05818 SIIIA[del1,D15A,insC_D] synthetic construct NCCNGGCSSKWCRAHARCCD(nh2)
P05816 SIIIA[del1,D15A,insC_K] synthetic construct NCCNGGCSSKWCRAHARCCK(nh2)
P05813 SIIIA[del1,D15A] synthetic construct NCCNGGCSSKWCRAHARCC(nh2)
P07457 SIIIA[del1,D15K] synthetic construct NCCNGGCSSKWCRKHARCC(nh2)
P07455 SIIIA[del1,H16A] synthetic construct NCCNGGCSSKWCRDAARCC(nh2)
P07465 SIIIA[del1,K11A,R14A,D15A,H16D,R18A] synthetic construct NCCNGGCSSAWCAADAACC(nh2)
P07464 SIIIA[del1,K11A,R14A,D15A,H16Y,R18A] synthetic construct NCCNGGCSSAWCAAYAACC(nh2)
P07463 SIIIA[del1,K11A,R14A,D15A,R18A] synthetic construct NCCNGGCSSAWCAAHAACC(nh2)
P07452 SIIIA[del1,K11A] synthetic construct NCCNGGCSSAWCRDHARCC(nh2)
P07462 SIIIA[del1,K11R,W12A,D15A] synthetic construct NCCNGGCSSRACRAHARCC(nh2)
P07458 SIIIA[del1,K11R,W12A] synthetic construct NCCNGGCSSRACRDHARCC(nh2)
P07454 SIIIA[del1,R14A] synthetic construct NCCNGGCSSKWCADHARCC(nh2)
P07456 SIIIA[del1,R18A] synthetic construct NCCNGGCSSKWCRDHAACC(nh2)
P07453 SIIIA[del1,W12A] synthetic construct NCCNGGCSSKACRDHARCC(nh2)
P05812 SIIIA[del1] synthetic construct NCCNGGCSSKWCRDHARCC(nh2)
P01615 SIIIB M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCKGHARCC(nh2)
P07451 SIIIB[del1] synthetic construct NCCNGGCSSKWCKGHARCC(nh2)
P02524 SIVA A superfamily Conus striatus (Striated cone) ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2)
P02525 SIVB A superfamily Conus striatus (Striated cone) ZKELVP(gSr)VITTCCGYDOGTMCOOCRCTNSCOTKOKKO
P02980 Sm1.1 A superfamily Conus stercusmuscarum GRCCHPACGONYSC(nh2)
P02903 Sm1.3 A superfamily Conus stercusmuscarum GCCSNPVCHLEHSN(Mox)C(nh2)
P05838 Sm1.4 Conus stercusmuscarum I(Mox)YDCCSGSCSGYTGRC(nh2)
P02530 SmIVA A superfamily Conus stercusmuscarum ZTWLVP(gSr)(gTr)ITTCCGYDOGTMCOTCMCDNTCKOK
P02529 SmIVB A superfamily Conus stercusmuscarum ZPWLVP(gSr)(gTr)ITTCCGYDOGSMCOOCMCNNTCKOK
P01540 SO3 O1 superfamily Conus striatus (Striated cone) CKAAGKPCSRIAYNCCTGSCRSGKC(nh2)
P03902 Sr1.1 synthetic construct RTCCSROTCRMEYPELCG(nh2)
P03646 Sr5.6/Sr5.8 T superfamily Conus spurius IMAGCCPRFYQCCYP(nh2)
P03752 SrIA A superfamily Conus spurius RTCCSROTCRM(Gla)YP(Gla)LCG(nh2)
P03901 SrIB A superfamily Conus spurius RTCCSROTCRMEYP(Gla)LCG(nh2)
P04445 SrIB [Gla15E] synthetic construct RTCCSROTCRMEYPELCG(nh2)
P01450 SrVIIA O1 superfamily Conus spurius CLQFGSTCFLGDDDICCSGECFYSGGTFGICS(nh2)
P02802 SrXIA I2 superfamily Conus spurius CRTEGMSC(Gla)(Gla)NQQCCWRSCCRGECEAPCRFGP(nh2)
P01794 SVIA O1 superfamily Conus striatus (Striated cone) CRSSGSOCGVTSICCGRCYRGKCT(nh2)
P01793 SVIB O1 superfamily Conus striatus (Striated cone) CKLKGQSCRKTSYDCCSGSCGRSGKC(nh2)
P03584 SxIIIA M superfamily Conus striolatus RCCTGKKGSCSGRACKNLKCCA(nh2)
P03585 SxIIIB M superfamily Conus striolatus ZKCCTGKKGSCSGRACKNLRCCA(nh2)
P09774 SxIIIC Conus striolatus RGCCNGRGGCSSRWCRDHARCC(nh2)
P02568 TeAr151 T superfamily Conus textile (Cloth-of-gold cone) VCCRPMQDCCS(nh2)
P01810 Textile convulsant peptide O1 superfamily Conus textile (Cloth-of-gold cone) NCPYCVVYCCPPAYCEASGCRPP(nh2)
P01634 TIA A superfamily Conus tulipa (tulip cone) FNWRCCLIPACRRNHKKFC(nh2)
P07441 TIA[del1-2] synthetic construct WRCCLIPACRRNHKKFC(nh2)
P07442 TIA[del1-3] synthetic construct RCCLIPACRRNHKKFC(nh2)
P07443 TIA[del1-4] synthetic construct CCLIPACRRNHKKFC(nh2)
P07440 TIA[del1] synthetic construct NWRCCLIPACRRNHKKFC(nh2)
P07444 TIA[del6-19] synthetic construct FNWRC(nh2)
P09041 TIA[del7-19] synthetic construct FNWRCC(nh2)
P07449 TIA[I8A] synthetic construct FNWRCCLAPACRRNHKKFC(nh2)
P07448 TIA[L7A] synthetic construct FNWRCCAIPACRRNHKKFC(nh2)
P07445 TIA[N2A] synthetic construct FAWRCCLIPACRRNHKKFC(nh2)
P07450 TIA[R12A] synthetic construct FNWRCCLIPACARNHKKFC(nh2)
P07447 TIA[R4A] synthetic construct FNWACCLIPACRRNHKKFC(nh2)
P07446 TIA[W3A] synthetic construct FNARCCLIPACRRNHKKFC(nh2)
P04228 TiIA Conus tinianus GGCCSHPACQNNPD(sTy)C(nh2)
P01616 TIIIA M superfamily Conus tulipa (tulip cone) RHGCCKGOKGCSSRECROQHCC(nh2)
P05821 TIIIA[E15A,insC_A] synthetic construct RHGCCKGOKGCSSRACROQHCCA(nh2)
P05822 TIIIA[E15A,insC_AA] synthetic construct RHGCCKGOKGCSSRACROQHCCAA(nh2)
P05826 TIIIA[E15A,insC_AD] synthetic construct RHGCCKGOKGCSSRACROQHCCAD(nh2)
P05825 TIIIA[E15A,insC_AK] synthetic construct RHGCCKGOKGCSSRACROQHCCAK(nh2)
P05824 TIIIA[E15A,insC_D] synthetic construct RHGCCKGOKGCSSRACROQHCCD(nh2)
P05823 TIIIA[E15A,insC_K] synthetic construct RHGCCKGOKGCSSRACROQHCCK(nh2)
P05820 TIIIA[E15A] synthetic construct RHGCCKGOKGCSSRACROQHCC(nh2)
P02712 Ts-011 T superfamily Conus tessulatus GCCEDKTCCFI(nh2)
P02715 Tx-D021 T superfamily Conus textile (Cloth-of-gold cone) SGCCVIDSNCC(nh2)
P02716 Tx1 A superfamily Conus textile (Cloth-of-gold cone) PECCSDPRCNSSHPELCG(nh2)
P03755 Tx10b Conus textile (Cloth-of-gold cone) DPCCGYRMCVOC(nh2)
P03754 Tx10c Conus textile (Cloth-of-gold cone) ZTCCGYRMCVOC(nh2)
P03753 Tx1c Conus textile (Cloth-of-gold cone) GCCSRPPCIANNPDIC(nh2)
P04977 Tx3-L02 M superfamily Conus textile (Cloth-of-gold cone) QCCDSNSCEYPKCLCCN(nh2)
P04978 Tx3-L03 M superfamily Conus textile (Cloth-of-gold cone) QCCDRNSCEYPKCLCCN(nh2)
P02560 Tx3a M superfamily Conus textile (Cloth-of-gold cone) CCSWDVCDHPSCTCCG(nh2)
P02564 Tx3f M superfamily Conus textile (Cloth-of-gold cone) RCCKFPCPDSCRYLCC(nh2)
P02565 Tx3h M superfamily Conus textile (Cloth-of-gold cone) KFCCDSNWCHISDCECCY(nh2)
P05831 Tx3i Conus textile (Cloth-of-gold cone) CCGOTACLAGCKPCC(nh2)
P02561 Tx5.1 T superfamily Conus textile (Cloth-of-gold cone) CCQTFYWCCVQ(nh2)
P05827 Tx5.2 Conus textile (Cloth-of-gold cone) CCPPVIWCC(nh2)
P05828 Tx5.3 Conus textile (Cloth-of-gold cone) QTCCGSKVFCC(nh2)
P05833 Tx5.5 Conus textile (Cloth-of-gold cone) NIQIICCKHTPKCCT(nh2)
P03756 Tx5c Conus textile (Cloth-of-gold cone) KPCCSIHDNSCCGI(nh2)
P03758 Tx5d Conus textile (Cloth-of-gold cone) NIQIICCKHTPACCT(nh2)
P05864 Tx5e Conus textile (Cloth-of-gold cone) PCCSKLHDNSCCGL(nh2)
P05837 Tx6.6 O1 superfamily Conus textile (Cloth-of-gold cone) DCQEKWDYCPVPFLGSRYCCDGFICPSFFCA(nh2)
P02881 TxIA A superfamily Conus textile (Cloth-of-gold cone) GCCSRPPCIANNPDLC(nh2)
P08958 TxIA[A10L] synthetic construct GCCSRPPCILNNPDLC(nh2)
P09049 TxIA[beads] synthetic construct GCCSRPPCIANNPDLC(nh2)
P08959 TxIA[ribbon] synthetic construct GCCSRPPCIANNPDLC(nh2)
P05345 TxIB Conus textile (Cloth-of-gold cone) GCCSDPPCRNKHPDLC(nh2)
P08486 TxIB[K11A] synthetic construct GCCSDPPCRNAHPDLC(nh2)
P05832 TxIC T superfamily Conus textile (Cloth-of-gold cone) DKQTCCGYRMCVOC(nh2)
P06831 TxID Conus textile (Cloth-of-gold cone) GCCSHPVCSAMSPIC(nh2)
P08418 TxID[S9(Abu)] synthetic construct GCCSHPVC(Abu)AMSPIC(nh2)
P08412 TxID[S9A] synthetic construct GCCSHPVCAAMSPIC(nh2)
P08423 TxID[S9D] synthetic construct GCCSHPVCDAMSPIC(nh2)
P08429 TxID[S9d] synthetic construct GCCSHPVCdAMSPIC(nh2)
P08426 TxID[S9E] synthetic construct GCCSHPVCEAMSPIC(nh2)
P08420 TxID[S9F] synthetic construct GCCSHPVCFAMSPIC(nh2)
P08424 TxID[S9H] synthetic construct GCCSHPVCHAMSPIC(nh2)
P08425 TxID[S9K] synthetic construct GCCSHPVCKAMSPIC(nh2)
P08419 TxID[S9L] synthetic construct GCCSHPVCLAMSPIC(nh2)
P08422 TxID[S9R] synthetic construct GCCSHPVCRAMSPIC(nh2)
P08428 TxID[S9r] synthetic construct GCCSHPVCrAMSPIC(nh2)
P08427 TxID[S9s] synthetic construct GCCSHPVCsAMSPIC(nh2)
P08417 TxID[S9T] synthetic construct GCCSHPVCTAMSPIC(nh2)
P08421 TxID[S9Y] synthetic construct GCCSHPVCYAMSPIC(nh2)
P02563 TxIIIB M superfamily Conus textile (Cloth-of-gold cone) CCPPVACNMGCKPCC(nh2)
P02562 TxIIIC M superfamily Conus textile (Cloth-of-gold cone) CCRTCFGCTOCC(nh2)
P02559 TxIXA P superfamily Conus textile (Cloth-of-gold cone) GCNNSCQ(Gla)HSDC(Gla)SHCICTFRGCGAVN(nh2)
P03170 TxMLKM-021 M superfamily Conus textile (Cloth-of-gold cone) VCCPFGGCHELCQCCE(nh2)
P01517 TxVIIA O2 superfamily Conus textile (Cloth-of-gold cone) CGGYSTYC(Gla)VDS(Gla)CCSDNCVRSYCTLF(nh2)
P02551 TxX I2 superfamily Conus textile (Cloth-of-gold cone) SCDS(Gla)FSS(Gla)FC(Gla)RP(Gla)(Gla)SCSCS
P02552 TxXI I2 superfamily Conus textile (Cloth-of-gold cone) CIP(Gla)GSSCSSSGSCCHKSCCRWTCNQPCLIP(nh2)
P00004 Vc1.1 synthetic construct GCCSDPRCNYDHPEIC(nh2)
P06292 Vc1.1 [C2(Agl),C8(Agl)] synthetic construct G(Agl)CSDPR(Agl)NYDHPEIC(nh2)
P09975 Vc1.1 [C2(Alk),C8(Alk)] synthetic construct G(Alk)CSDPR(Alk)NYDHPEIC(nh2)
P09976 Vc1.1 [C2(Aly),C8(Aly)] synthetic construct G(Aly)CSDPR(Aly)NYDHPEIC(nh2)
P06293 Vc1.1 [C3(Agl),C16(Agl)] synthetic construct GC(Agl)SDPRCNYDHPEI(Agl)(nh2)
P04467 Vc1.1 [E14Gla] synthetic construct GCCSDPRCNYDHP(Gla)IC(nh2)
P04466 Vc1.1 [P6O] synthetic construct GCCSDORCNYDHPEIC(nh2)
P09082 Vc1.1 N-term benzoylated synthetic construct (Bnz)GCCSDPRCNYDHPEIC(nh2)
P08436 Vc1.1[C2H,C8F] synthetic construct GHCSDPRFNYDHPEIC(nh2)
P09010 Vc1.1[D11(Gla)] synthetic construct GCCSDPRCNY(Gla)HPEIC(nh2)
P03654 Vc1.1[D11A] synthetic construct GCCSDPRCNYAHPEIC(nh2)
P09009 Vc1.1[D11E] synthetic construct GCCSDPRCNYEHPEIC(nh2)
P03665 Vc1.1[D11K] synthetic construct GCCSDPRCNYKHPEIC(nh2)
P09073 Vc1.1[D11N] synthetic construct GCCSDPRCNYNHPEIC(nh2)
P03649 Vc1.1[D5A] synthetic construct GCCSAPRCNYDHPEIC(nh2)
P03661 Vc1.1[D5K] synthetic construct GCCSKPRCNYDHPEIC(nh2)
P07439 Vc1.1[del 9-16, C3S] synthetic construct GCSSDPRC(nh2)
P09081 Vc1.1[del1G,N9R] synthetic construct CCSDPRCRYDHPEIC(nh2)
P03657 Vc1.1[E14A] synthetic construct GCCSDPRCNYDHPAIC(nh2)
P03679 Vc1.1[E14D] synthetic construct GCCSDPRCNYDHPDIC(nh2)
P03668 Vc1.1[E14K] synthetic construct GCCSDPRCNYDHPKIC(nh2)
P03647 Vc1.1[G1A] synthetic construct ACCSDPRCNYDHPEIC(nh2)
P03671 Vc1.1[G1D] synthetic construct DCCSDPRCNYDHPEIC(nh2)
P03659 Vc1.1[G1K] synthetic construct KCCSDPRCNYDHPEIC(nh2)
P03655 Vc1.1[H12A] synthetic construct GCCSDPRCNYDAPEIC(nh2)
P03677 Vc1.1[H12D] synthetic construct GCCSDPRCNYDDPEIC(nh2)
P03666 Vc1.1[H12K] synthetic construct GCCSDPRCNYDKPEIC(nh2)
P03658 Vc1.1[I15A] synthetic construct GCCSDPRCNYDHPEAC(nh2)
P03680 Vc1.1[I15D] synthetic construct GCCSDPRCNYDHPEDC(nh2)
P03669 Vc1.1[I15K] synthetic construct GCCSDPRCNYDHPEKC(nh2)
P09011 Vc1.1[N9A] synthetic construct GCCSDPRCAYDHPEIC(nh2)
P03652 Vc1.1[N9A] synthetic construct GCCSDPRCAYDHPEIC(nh2)
P03675 Vc1.1[N9D] synthetic construct GCCSDPRCDYDHPEIC(nh2)
P05356 Vc1.1[N9F] synthetic construct GCCSDPRCFYDHPEIC(nh2)
P03683 Vc1.1[N9G] synthetic construct GCCSDPRCGYDHPEIC(nh2)
P03681 Vc1.1[N9I] synthetic construct GCCSDPRCIYDHPEIC(nh2)
P03664 Vc1.1[N9K] synthetic construct GCCSDPRCKYDHPEIC(nh2)
P03682 Vc1.1[N9L] synthetic construct GCCSDPRCLYDHPEIC(nh2)
P09076 Vc1.1[N9R,D11N] synthetic construct GCCSDPRCRYNHPEIC(nh2)
P09078 Vc1.1[N9R,D11R] synthetic construct GCCSDPRCRYRHPEIC(nh2)
P09077 Vc1.1[N9R,D11S] synthetic construct GCCSDPRCRYSHPEIC(nh2)
P09079 Vc1.1[N9R] synthetic construct GCCSDPRCRYDHPEIC(nh2)
P09080 Vc1.1[N9R] acetylated synthetic construct (Ac)GCCSDPRCRYDHPEIC(nh2)
P09075 Vc1.1[N9R] N-term benzoylated synthetic construct (Bnz)GCCSDPRCRYDHPEIC(nh2)
P09074 Vc1.1[N9S,Y10V,D11N,I15L] synthetic construct GCCSDPRCSVNHPELC(nh2)
P09012 Vc1.1[N9W] synthetic construct GCCSDPRCWYDHPEIC(nh2)
P05357 Vc1.1[N9W] synthetic construct GCCSDPRCWYDHPEIC(nh2)
P03656 Vc1.1[P13A] synthetic construct GCCSDPRCNYDHAEIC(nh2)
P03678 Vc1.1[P13D] synthetic construct GCCSDPRCNYDHDEIC(nh2)
P03667 Vc1.1[P13K] synthetic construct GCCSDPRCNYDHKEIC(nh2)
P09005 Vc1.1[P6(Hyp)] synthetic construct GCCSDORCNYDHPEIC(nh2)
P03650 Vc1.1[P6A] synthetic construct GCCSDARCNYDHPEIC(nh2)
P03673 Vc1.1[P6D] synthetic construct GCCSDDRCNYDHPEIC(nh2)
P03662 Vc1.1[P6K] synthetic construct GCCSDKRCNYDHPEIC(nh2)
P03651 Vc1.1[R7A] synthetic construct GCCSDPACNYDHPEIC(nh2)
P03674 Vc1.1[R7D] synthetic construct GCCSDPDCNYDHPEIC(nh2)
P03663 Vc1.1[R7K] synthetic construct GCCSDPKCNYDHPEIC(nh2)
P09013 Vc1.1[S4(Dab),N9A] synthetic construct GCC(Dab)DPRCAYDHPEIC(nh2)
P09014 Vc1.1[S4(Dab),N9W] synthetic construct GCC(Dab)DPRCWYDHPEIC(nh2)
P09003 Vc1.1[S4(Dab)] synthetic construct GCC(Dab)DPRCNYDHPEIC(nh2)
P09004 Vc1.1[S4(Dap)] synthetic construct GCC(Dap)DPRCNYDHPEIC(nh2)
P03648 Vc1.1[S4A] synthetic construct GCCADPRCNYDHPEIC(nh2)
P03672 Vc1.1[S4D] synthetic construct GCCDDPRCNYDHPEIC(nh2)
P03685 Vc1.1[S4K,N9A] synthetic construct GCCKDPRCAYDHPEIC(nh2)
P03660 Vc1.1[S4K] synthetic construct GCCKDPRCNYDHPEIC(nh2)
P09002 Vc1.1[S4K] synthetic construct GCCKDPRCNYDHPEIC(nh2)
P03684 Vc1.1[S4R] synthetic construct GCCRDPRCNYDHPEIC(nh2)
P09007 Vc1.1[Y10(F(4-Cl))] synthetic construct GCCSDPRCN(F(4-Cl))DHPEIC(nh2)
P09008 Vc1.1[Y10(F(4-F))] synthetic construct GCCSDPRCN(F(4-F))DHPEIC(nh2)
P03653 Vc1.1[Y10A] synthetic construct GCCSDPRCNADHPEIC(nh2)
P03676 Vc1.1[Y10D] synthetic construct GCCSDPRCNDDHPEIC(nh2)
P09006 Vc1.1[Y10F] synthetic construct GCCSDPRCNFDHPEIC(nh2)
P03670 Vc1.1[Y10K] synthetic construct GCCSDPRCNKDHPEIC(nh2)
P04279 Vc6.17 O2 superfamily Conus victoriae LCPDYTDPCSNAYECCSWNCHNGHCT(nh2)
P02539 VcIA A superfamily Conus victoriae GCCSDORCNYDHP(Gla)IC(nh2)
P02540 VcVA T superfamily Conus victoriae CCPGKOCCRI(nh2)
P02541 VcVB T superfamily Conus victoriae CCQTFYWCCGQ(nh2)
P04511 Vi11.2 I2 superfamily Conus virgo CLRDGQSCGYDSDCCRYSCCWGYCDLTCLII(nh2)
P04515 Vi11.3 I2 superfamily Conus virgo CFPPGVYCTRHLPCCRGRCCSGWCRPRCFPRF(nh2)
P04514 Vi11.5 I2 superfamily Conus virgo CRLEGSSCRRSYQCCHKSCCIRECKFPCRWV(nh2)
P02788 Vi1361 Conus virgo ZCCPTMPECCRI(nh2)
P04519 Vi6.7 O3 superfamily Conus virgo TVDEACNEYCEERNKNCCGRTDGEPVCAQACL(nh2)
P06858 ViIA A superfamily Conus virgo RDCCSNPPCAHNNPDC(nh2)
P06861 ViIA[R1A] synthetic construct ADCCSNPPCAHNNPDC(nh2)
P06864 VilA deamidated synthetic construct RDCCSNPPCAHNNPD(nh2)
P06862 VilA[D2A] synthetic construct RACCSNPPCAHNNPDC(nh2)
P06863 VilA[H11A] synthetic construct RDCCSNPPCAANNPDC(nh2)
P06860 VilA[ins15_L] synthetic construct RDCCSNPPCAHNNPDLC(nh2)
P01672 ViVA T superfamily Conus virgo ZCCITIPECCRI(nh2)
P01671 ViVB T superfamily Conus virgo ZCCPTIPECCRV(nh2)
P02836 ViXVA V superfamily Conus virgo DCTTCAGEECCGRCTCPWGDNCSCIEW(nh2)
P04985 Vr3-T05 M superfamily Conus varius EIILHALGTRCCSWDVCDHPSCTCC(nh2)
P02837 Vt15.1 V superfamily Conus vitulinus ACHTCDDGTECCDSRCSCPWNTCTCIPW(nh2)
P04220 Vt3.1 M superfamily Conus vitulinus GPYRRYGNCYCPI(nh2)
P04233 Vt3.2 M superfamily Conus vitulinus GPYRRHGNCFCPS(nh2)