Protein List

Your search: PTM in [D-leucine]

Found 9 entries.


ID Name Gene superfamily Organism Sequence
P02870 ArXIA I1 superfamily Conus arenatus RTCSRRGHRCIRDSQCCGGMCCQGNRCFVAIRRCFHlPF
P02592 RXIC I1 superfamily Conus radiatus GOSFCKADEKOCKYHADCCNCCLGGICKOSTSWIGCSTNVF
lT
P01421 Fi11.1a I1 superfamily Conus figulinus GHVSCGKDGRACDYHADCCNCCLGGICKPSTSWIGCSTNVF
lTR
P00841 R11.17 I1 superfamily Conus radiatus GOSFCKANGKOCSYHADCCNCCLSGICAOSTNWILPGCSTS
SFlKI
P00837 R11.18 I1 superfamily Conus radiatus GAVPCGKDGRQCRNHADCCNCCPFGTCAPSTNRILPGCSTG
MFlTR
P00831 R11.13 I1 superfamily Conus radiatus GHVPCGKDGRKCGYHADCCNCCLSGICKPSTSWTGCSTSTF
LlTR
P00830 R11.12 I1 superfamily Conus radiatus GHVPCGKDRRKCGYHADCCNCCLSGICKPSTSWTGCSTSTF
LlTR
P00829 R11.10 I1 superfamily Conus radiatus GHVPCGKDGRKCGYHADCCNCCLSGICKPSTSWTGCSTSTV
QlTR
P02659 Leu-contryphan-Tx O2 superfamily Conus textile (Cloth-of-gold cone) CVlYPWC(nh2)